Recombinant Human MAPK9 protein(331-420 aa), C-His-tagged
Cat.No. : | MAPK9-2766H |
Product Overview : | Recombinant Human MAPK9 protein(P45984)(331-420 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 331-420 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL |
Gene Name | MAPK9 mitogen-activated protein kinase 9 [ Homo sapiens ] |
Official Symbol | MAPK9 |
Synonyms | MAPK9; mitogen-activated protein kinase 9; PRKM9; JNK2; Jun kinase; p54a; SAPK; MAPK 9; MAP kinase 9; c-Jun kinase 2; c-Jun N-terminal kinase 2; stress-activated protein kinase 1a; stress-activated protein kinase JNK2; JNK2A; JNK2B; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA; |
Gene ID | 5601 |
mRNA Refseq | NM_001135044 |
Protein Refseq | NP_001128516 |
MIM | 602896 |
UniProt ID | P45984 |
◆ Recombinant Proteins | ||
MAPK9-1349H | Recombinant Human Mitogen-Activated Protein Kinase 9, His-tagged | +Inquiry |
Mapk9-3948M | Recombinant Mouse Mapk9 Protein, Myc/DDK-tagged | +Inquiry |
MAPK9-3206H | Recombinant Human MAPK9 protein, His-SUMO-tagged | +Inquiry |
MAPK9-155H | Recombinant Human MAPK9 protein, His/MBP-tagged | +Inquiry |
MAPK9-1139H | Recombinant Human MAPK9 Protein (M1-E364), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK9-4486HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
MAPK9-4485HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
MAPK9-4487HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPK9 Products
Required fields are marked with *
My Review for All MAPK9 Products
Required fields are marked with *
0
Inquiry Basket