Recombinant Human MAPK9 protein(331-420 aa), C-His-tagged

• Cat.No.: MAPK9-2766H
• Product Overview: Recombinant Human MAPK9 protein(P45984)(331-420 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 331-420 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL

Gene Information

• Gene Name: MAPK9 mitogen-activated protein kinase 9 [ Homo sapiens ]
• Official Symbol: MAPK9
• Synonyms: MAPK9; mitogen-activated protein kinase 9; PRKM9; JNK2; Jun kinase; p54a; SAPK; MAPK 9; MAP kinase 9; c-Jun kinase 2; c-Jun N-terminal kinase 2; stress-activated protein kinase 1a; stress-activated protein kinase JNK2; JNK2A; JNK2B; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA
• Gene ID: 5601
• mRNA Refseq: NM_001135044
• Protein Refseq: NP_001128516
• MIM: 602896
• UniProt ID: P45984