Recombinant Human MAPK9 protein(331-420 aa), C-His-tagged
| Cat.No. : | MAPK9-2766H |
| Product Overview : | Recombinant Human MAPK9 protein(P45984)(331-420 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 331-420 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL |
| Gene Name | MAPK9 mitogen-activated protein kinase 9 [ Homo sapiens ] |
| Official Symbol | MAPK9 |
| Synonyms | MAPK9; mitogen-activated protein kinase 9; PRKM9; JNK2; Jun kinase; p54a; SAPK; MAPK 9; MAP kinase 9; c-Jun kinase 2; c-Jun N-terminal kinase 2; stress-activated protein kinase 1a; stress-activated protein kinase JNK2; JNK2A; JNK2B; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA; |
| Gene ID | 5601 |
| mRNA Refseq | NM_001135044 |
| Protein Refseq | NP_001128516 |
| MIM | 602896 |
| UniProt ID | P45984 |
| ◆ Recombinant Proteins | ||
| MAPK9-4997H | Recombinant Human MAPK9 Protein (Tyr26-Ile321), N-His tagged | +Inquiry |
| MAPK9-45H | Recombinant Human Mitogen-activated Protein Kinase 9 | +Inquiry |
| MAPK9-84HFL | Active Recombinant Full Length Human MAPK9 Protein, N-His-tagged | +Inquiry |
| MAPK9-1266H | Recombinant Human Mitogen-Activated Protein Kinase 9, His-tagged | +Inquiry |
| MAPK9-44H | Recombinant Human Mitogen-activated Protein Kinase 9, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAPK9-4487HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
| MAPK9-4485HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
| MAPK9-4486HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPK9 Products
Required fields are marked with *
My Review for All MAPK9 Products
Required fields are marked with *



