Recombinant Human MAPK9 protein(331-420 aa), C-His-tagged

Cat.No. : MAPK9-2766H
Product Overview : Recombinant Human MAPK9 protein(P45984)(331-420 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 331-420 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
Gene Name MAPK9 mitogen-activated protein kinase 9 [ Homo sapiens ]
Official Symbol MAPK9
Synonyms MAPK9; mitogen-activated protein kinase 9; PRKM9; JNK2; Jun kinase; p54a; SAPK; MAPK 9; MAP kinase 9; c-Jun kinase 2; c-Jun N-terminal kinase 2; stress-activated protein kinase 1a; stress-activated protein kinase JNK2; JNK2A; JNK2B; JNK-55; SAPK1a; JNK2BETA; p54aSAPK; JNK2ALPHA;
Gene ID 5601
mRNA Refseq NM_001135044
Protein Refseq NP_001128516
MIM 602896
UniProt ID P45984

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPK9 Products

Required fields are marked with *

My Review for All MAPK9 Products

Required fields are marked with *

0
cart-icon