Recombinant Human MAPKAP1, His-tagged
Cat.No. : | MAPKAP1-29583TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-330 of Human SIN1 with N terminal His tag, 55kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-330 a.a. |
Description : | This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3 UTRs have been identified for transcripts of this gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitously expressed, with highest levels in heart and skeletal muscle. |
Form : | Lyophilised:Reconstitute with 78 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCL HIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSS PGLTSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWE FCLVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSF KVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIK QKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYK HLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQ RKLNRRTSFSFQKEKKSGQQ |
Sequence Similarities : | Belongs to the SIN1 family. |
Full Length : | Full L. |
Gene Name | MAPKAP1 mitogen-activated protein kinase associated protein 1 [ Homo sapiens ] |
Official Symbol | MAPKAP1 |
Synonyms | MAPKAP1; mitogen-activated protein kinase associated protein 1; target of rapamycin complex 2 subunit MAPKAP1; MGC2745; MIP1; SIN1; stress activated protein kinase interacting 1; |
Gene ID | 79109 |
mRNA Refseq | NM_001006617 |
Protein Refseq | NP_001006618 |
MIM | 610558 |
Uniprot ID | Q9BPZ7 |
Chromosome Location | 9q34.11 |
Pathway | Adaptive Immune System, organism-specific biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; CXCR3-mediated signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; |
Function | Ras GTPase binding; |
◆ Recombinant Proteins | ||
MAPKAP1-6721H | Recombinant Human MAPKAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mapkap1-3949M | Recombinant Mouse Mapkap1 Protein, Myc/DDK-tagged | +Inquiry |
MAPKAP1-1763H | Recombinant Human MAPKAP1 Protein, His&GST-tagged | +Inquiry |
MAPKAP1-3233R | Recombinant Rat MAPKAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPKAP1-1280HFL | Recombinant Full Length Human MAPKAP1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPKAP1-4483HCL | Recombinant Human MAPKAP1 293 Cell Lysate | +Inquiry |
MAPKAP1-4484HCL | Recombinant Human MAPKAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPKAP1 Products
Required fields are marked with *
My Review for All MAPKAP1 Products
Required fields are marked with *
0
Inquiry Basket