Recombinant Human MBD1 protein, His-tagged
| Cat.No. : | MBD1-6755H |
| Product Overview : | Recombinant Human MBD1 protein(393-605 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 393-605 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | SEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MBD1 methyl-CpG binding domain protein 1 [ Homo sapiens ] |
| Official Symbol | MBD1 |
| Synonyms | MBD1; methyl-CpG binding domain protein 1; methyl-CpG-binding domain protein 1; CXXC3; PCM1; CXXC-type zinc finger protein 3; protein containing methyl-CpG-binding domain 1; methyl-CpG binding domain protein 1 isoform PCM1; the regulator of fibroblast growth factor 2 (FGF-2) transcription; RFT; |
| Gene ID | 4152 |
| mRNA Refseq | NM_001204136 |
| Protein Refseq | NP_001191065 |
| MIM | 156535 |
| UniProt ID | Q9UIS9 |
| ◆ Recombinant Proteins | ||
| MBD1-6755H | Recombinant Human MBD1 protein, His-tagged | +Inquiry |
| MBD1-2425H | Recombinant Human MBD1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MBD1-1064HCL | Recombinant Human MBD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBD1 Products
Required fields are marked with *
My Review for All MBD1 Products
Required fields are marked with *



