Recombinant Human MBD2 protein, hFc-tagged
Cat.No. : | MBD2-5643H |
Product Overview : | Recombinant Human MBD2 protein(Q9UBB5)(145-411aa), fused with C-terminal hFc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Fc |
Protein Length : | 145-411aa |
Tag : | C-hFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA |
Gene Name | MBD2 methyl-CpG binding domain protein 2 [ Homo sapiens ] |
Official Symbol | MBD2 |
Synonyms | MBD2; methyl-CpG binding domain protein 2; methyl-CpG-binding domain protein 2; demethylase; DMTase; NY-CO-41; DKFZp586O0821; |
Gene ID | 8932 |
mRNA Refseq | NM_003927 |
Protein Refseq | NP_003918 |
MIM | 603547 |
UniProt ID | Q9UBB5 |
◆ Recombinant Proteins | ||
MBD2-405H | Recombinant Human MBD2 Protein, His-tagged | +Inquiry |
MBD2-4938H | Recombinant Human MBD2 protein(143-411aa), His-KSI-tagged | +Inquiry |
MBD2-1893C | Recombinant Chicken MBD2 | +Inquiry |
MBD2-12037Z | Recombinant Zebrafish MBD2 | +Inquiry |
MBD2-5643H | Recombinant Human MBD2 protein, hFc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBD2 Products
Required fields are marked with *
My Review for All MBD2 Products
Required fields are marked with *
0
Inquiry Basket