Recombinant Human MBD3 protein, T7/His-tagged
Cat.No. : | MBD3-223H |
Product Overview : | Recombinant human MBD3 cDNA (259aa, Isoform-II, derived from BC043619) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 259 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQ RVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEE LVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQE ELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ] |
Official Symbol | MBD3 |
Synonyms | MBD3; methyl-CpG binding domain protein 3; |
Gene ID | 8931 |
mRNA Refseq | |
Protein Refseq | |
MIM | |
UniProt ID |
◆ Recombinant Proteins | ||
MBD3-223H | Recombinant Human MBD3 protein, T7/His-tagged | +Inquiry |
MBD3-2512R | Recombinant Rhesus Macaque MBD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MBD3-7179H | Recombinant Human Methyl-CpG Binding Domain Protein 3, His-tagged | +Inquiry |
MBD3-28525TH | Recombinant Human MBD3, His-tagged | +Inquiry |
MBD3-3583C | Recombinant Chicken MBD3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBD3-1065HCL | Recombinant Human MBD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBD3 Products
Required fields are marked with *
My Review for All MBD3 Products
Required fields are marked with *