Recombinant Human MBL2 Protein, His-tagged

Cat.No. : MBL2-377H
Product Overview : Recombinant human MBL2 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 248
Description : This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Form : Lyophilized
Molecular Mass : 24.8 kDa
AA Sequence : MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name MBL2 mannose-binding lectin (protein C) 2, soluble [ Homo sapiens (human) ]
Official Symbol MBL2
Synonyms MBL2; mannose-binding lectin (protein C) 2, soluble; mannose binding lectin (protein C) 2, soluble (opsonic defect) , MBL; mannose-binding protein C; COLEC1; collectin-1; mannan-binding lectin; mannose-binding lectin 2, soluble (opsonic defect); mannose-binding lectin (protein C) 2, soluble (opsonic defect); MBL; MBP; MBP1; MBL2D; MBP-C; HSMBPC; MGC116832; MGC116833;
Gene ID 4153
mRNA Refseq NM_000242
Protein Refseq NP_000233
MIM 154545
UniProt ID P11226

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MBL2 Products

Required fields are marked with *

My Review for All MBL2 Products

Required fields are marked with *

0
cart-icon