Recombinant Human MBLAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MBLAC2-1548H |
Product Overview : | MBLAC2 MS Standard C13 and N15-labeled recombinant protein (NP_981951) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MBLAC2 (Metallo-Beta-Lactamase Domain Containing 2) is a Protein Coding gene. Diseases associated with MBLAC2 include Jalili Syndrome and Tetralogy Of Fallot. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is PNKD. |
Molecular Mass : | 31.3 kDa |
AA Sequence : | MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKEDAARRPLLAVATHVHFDHSGGLYQFDRVAVHHAEAEALARGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLIDWLPYSRISDYVGTCERLIELVDRGLVEKVLPGHFNTFGAERLFRLASNYISKAGICHKVSTFAMRSLASLALRVTNSRTSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MBLAC2 metallo-beta-lactamase domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | MBLAC2 |
Synonyms | MBLAC2; metallo-beta-lactamase domain containing 2; MBLAC2; metallo-beta-lactamase domain containing 2; metallo-beta-lactamase domain-containing protein 2 |
Gene ID | 153364 |
mRNA Refseq | NM_203406 |
Protein Refseq | NP_981951 |
UniProt ID | Q68D91 |
◆ Recombinant Proteins | ||
MBLAC2-2515R | Recombinant Rhesus Macaque MBLAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mblac2-3981M | Recombinant Mouse Mblac2 Protein, Myc/DDK-tagged | +Inquiry |
MBLAC2-1377H | Recombinant Human MBLAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MBLAC2-1548H | Recombinant Human MBLAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MBLAC2-1242HFL | Recombinant Full Length Human MBLAC2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBLAC2-4442HCL | Recombinant Human MBLAC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBLAC2 Products
Required fields are marked with *
My Review for All MBLAC2 Products
Required fields are marked with *