Recombinant Human MBNL1
Cat.No. : | MBNL1-30258TH |
Product Overview : | Recombinant full length Human Muscleblind-like 1 according to AAH50535,with N-terminal proprietary tag.Mol Wt 63.84 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 343 amino acids |
Description : | Muscleblind-like (Drosophila), also known as MBNL1, is a protein that in humans is encoded by the MBNL1 gene. It has been implicated in Myotonic dystrophy and has been shown to autoregulate its transcript. |
Molecular Weight : | 63.840kDa inclusive of tags |
Tissue specificity : | Highly expressed in cardiac, skeletal muscle and during myoblast differentiation. Weakly expressed in other tissues (at protein level). Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLA QQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYL GPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLM RTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNT VTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQA AAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPL PKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLP PGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAAT ATANQIPIISAEHLTSHKYVTQM |
Sequence Similarities : | Belongs to the muscleblind family.Contains 4 C3H1-type zinc fingers. |
Gene Name | MBNL1 muscleblind-like (Drosophila) [ Homo sapiens ] |
Official Symbol | MBNL1 |
Synonyms | MBNL1; muscleblind-like (Drosophila); MBNL, muscleblind (Drosophila) like; muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428; |
Gene ID | 4154 |
mRNA Refseq | NM_207294 |
Protein Refseq | NP_997177 |
MIM | 606516 |
Uniprot ID | Q9NR56 |
Chromosome Location | 3q25 |
Pathway | Adipogenesis, organism-specific biosystem; |
Function | RNA binding; double-stranded RNA binding; metal ion binding; nucleic acid binding; protein binding; |
◆ Recombinant Proteins | ||
MBNL1-6556H | Recombinant Human MBNL1 protein, His/SUMO-tagged | +Inquiry |
MBNL1-660H | Recombinant Human MBNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MBNL1-2737H | Recombinant Human MBNL1, MYC/DDK-tagged | +Inquiry |
MBNL1-8967HFL | Recombinant Full Length Human MBNL1 protein, Flag-tagged | +Inquiry |
MBNL1-2139H | Recombinant Human MBNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBNL1-4441HCL | Recombinant Human MBNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBNL1 Products
Required fields are marked with *
My Review for All MBNL1 Products
Required fields are marked with *
0
Inquiry Basket