Recombinant Human MCAT Protein, GST-tagged
Cat.No. : | MCAT-5680H |
Product Overview : | Human MT partial ORF ( NP_775738, 291 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MCAT malonyl CoA:ACP acyltransferase (mitochondrial) [ Homo sapiens ] |
Official Symbol | MCAT |
Synonyms | MCAT; malonyl CoA:ACP acyltransferase (mitochondrial); malonyl-CoA-acyl carrier protein transacylase, mitochondrial; fabD; FASN2C; MCT; MT; NET62; mitochondrial malonyltransferase; [Acyl-carrier-protein] malonyltransferase; mitochondrial malonyl CoA:ACP acyltransferase; malonyl-CoA:acyl carrier protein transacylase, mitochondrial; MGC47838; |
Gene ID | 27349 |
mRNA Refseq | NM_014507 |
Protein Refseq | NP_055322 |
MIM | 614479 |
UniProt ID | Q8IVS2 |
◆ Recombinant Proteins | ||
MCAT-2698R | Recombinant Rhesus monkey MCAT Protein, His-tagged | +Inquiry |
MCAT-773H | Recombinant Human MCAT, His-tagged | +Inquiry |
Mcat-3989M | Recombinant Mouse Mcat Protein, Myc/DDK-tagged | +Inquiry |
MCAT-5680H | Recombinant Human MCAT Protein, GST-tagged | +Inquiry |
MCAT-5054H | Recombinant Human MCAT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCAT-4432HCL | Recombinant Human MCAT 293 Cell Lysate | +Inquiry |
MCAT-4431HCL | Recombinant Human MCAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCAT Products
Required fields are marked with *
My Review for All MCAT Products
Required fields are marked with *
0
Inquiry Basket