Recombinant Human MCAT Protein, GST-tagged
| Cat.No. : | MCAT-5680H |
| Product Overview : | Human MT partial ORF ( NP_775738, 291 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MCAT malonyl CoA:ACP acyltransferase (mitochondrial) [ Homo sapiens ] |
| Official Symbol | MCAT |
| Synonyms | MCAT; malonyl CoA:ACP acyltransferase (mitochondrial); malonyl-CoA-acyl carrier protein transacylase, mitochondrial; fabD; FASN2C; MCT; MT; NET62; mitochondrial malonyltransferase; [Acyl-carrier-protein] malonyltransferase; mitochondrial malonyl CoA:ACP acyltransferase; malonyl-CoA:acyl carrier protein transacylase, mitochondrial; MGC47838; |
| Gene ID | 27349 |
| mRNA Refseq | NM_014507 |
| Protein Refseq | NP_055322 |
| MIM | 614479 |
| UniProt ID | Q8IVS2 |
| ◆ Recombinant Proteins | ||
| MCAT-2518R | Recombinant Rhesus Macaque MCAT Protein, His (Fc)-Avi-tagged | +Inquiry |
| MCAT-5054H | Recombinant Human MCAT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MCAT-5404M | Recombinant Mouse MCAT Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mcat-3989M | Recombinant Mouse Mcat Protein, Myc/DDK-tagged | +Inquiry |
| MCAT-9622M | Recombinant Mouse MCAT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MCAT-4432HCL | Recombinant Human MCAT 293 Cell Lysate | +Inquiry |
| MCAT-4431HCL | Recombinant Human MCAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCAT Products
Required fields are marked with *
My Review for All MCAT Products
Required fields are marked with *



