Recombinant Human MCAT Protein, GST-tagged

Cat.No. : MCAT-5680H
Product Overview : Human MT partial ORF ( NP_775738, 291 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MCAT malonyl CoA:ACP acyltransferase (mitochondrial) [ Homo sapiens ]
Official Symbol MCAT
Synonyms MCAT; malonyl CoA:ACP acyltransferase (mitochondrial); malonyl-CoA-acyl carrier protein transacylase, mitochondrial; fabD; FASN2C; MCT; MT; NET62; mitochondrial malonyltransferase; [Acyl-carrier-protein] malonyltransferase; mitochondrial malonyl CoA:ACP acyltransferase; malonyl-CoA:acyl carrier protein transacylase, mitochondrial; MGC47838;
Gene ID 27349
mRNA Refseq NM_014507
Protein Refseq NP_055322
MIM 614479
UniProt ID Q8IVS2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MCAT Products

Required fields are marked with *

My Review for All MCAT Products

Required fields are marked with *

0
cart-icon