Recombinant Human MCAT Protein, GST-tagged

• Cat.No.: MCAT-5680H
• Product Overview: Human MT partial ORF ( NP_775738, 291 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MCAT malonyl CoA:ACP acyltransferase (mitochondrial) [ Homo sapiens ]
• Official Symbol: MCAT
• Synonyms: MCAT; malonyl CoA:ACP acyltransferase (mitochondrial); malonyl-CoA-acyl carrier protein transacylase, mitochondrial; fabD; FASN2C; MCT; MT; NET62; mitochondrial malonyltransferase; [Acyl-carrier-protein] malonyltransferase; mitochondrial malonyl CoA:ACP acyltransferase; malonyl-CoA:acyl carrier protein transacylase, mitochondrial; MGC47838
• Gene ID: 27349
• mRNA Refseq: NM_014507
• Protein Refseq: NP_055322
• MIM: 614479
• UniProt ID: Q8IVS2