Recombinant Human MCF2L protein, GST-tagged
Cat.No. : | MCF2L-301406H |
Product Overview : | Recombinant Human MCF2L (328-591 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Phe328-Glu591 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | FREVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHLCDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MCF2L MCF.2 cell line derived transforming sequence-like [ Homo sapiens ] |
Official Symbol | MCF2L |
Synonyms | MCF2L; MCF.2 cell line derived transforming sequence-like; guanine nucleotide exchange factor DBS; ARHGEF14; DBS; KIAA0362; OST; DBLs big sister; MCF2 transforming sequence-like protein; FLJ12122; |
Gene ID | 23263 |
mRNA Refseq | NM_001112732 |
Protein Refseq | NP_001106203 |
MIM | 609499 |
UniProt ID | O15068 |
◆ Recombinant Proteins | ||
MCF2L-4536C | Recombinant Chicken MCF2L | +Inquiry |
Mcf2l-3993M | Recombinant Mouse Mcf2l Protein, Myc/DDK-tagged | +Inquiry |
MCF2L-301406H | Recombinant Human MCF2L protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCF2L-1068HCL | Recombinant Human MCF2L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCF2L Products
Required fields are marked with *
My Review for All MCF2L Products
Required fields are marked with *