Recombinant Human MCM3, GST-tagged

Cat.No. : MCM3-23H
Product Overview : Recombinant Human MCM3( 699 a.a. - 808 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 37.84 kDa
AA Sequence : AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESIN RDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MCM3 minichromosome maintenance complex component 3 [ Homo sapiens ]
Official Symbol MCM3
Synonyms MCM3; minichromosome maintenance complex component 3; HCC5; P1.h; RLFB; P1-MCM3; DNA replication licensing factor MCM3; p102; RLF subunit beta; hRlf beta subunit; DNA replication factor MCM3; cervical cancer proto-oncogene 5; minichromosome maintenance deficient 3; replication licensing factor, beta subunit; replication licensing factor, beta subunit; DNA polymerase alpha holoenzyme-associated protein P1; NP_001257401.1; EC 3.6.4.12; NP_002379.3
Gene ID 4172
mRNA Refseq NM_002388
Protein Refseq NP_002379
MIM 602693
UniProt ID P25205
Chromosome Location 6p12
Pathway Activation of ATR in response to replication sress; DNA Replication; E2F transcription factor network; G2/M Checkpoints
Function ATP binding; DNA binding; DNA helicase activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MCM3 Products

Required fields are marked with *

My Review for All MCM3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon