Recombinant Human MCU Protein, GST-tagged
Cat.No. : | MCU-4505H |
Product Overview : | Human MCU full-length ORF ( NP_612366.1, 1 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a calcium transporter that localizes to the mitochondrial inner membrane. The encoded protein interacts with mitochondrial calcium uptake 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 66.3 kDa |
AA Sequence : | MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MCU mitochondrial calcium uniporter [ Homo sapiens ] |
Official Symbol | MCU |
Synonyms | C10orf42; CCDC109A; MCU; mitochondrial calcium uniporter |
Gene ID | 90550 |
mRNA Refseq | NM_138357 |
Protein Refseq | NP_612366 |
MIM | 614197 |
UniProt ID | Q8NE86 |
◆ Recombinant Proteins | ||
MCU-4505H | Recombinant Human MCU Protein, GST-tagged | +Inquiry |
MCU-4684Z | Recombinant Zebrafish MCU | +Inquiry |
MCU-5273H | Recombinant Human MCU Protein (Val51-Thr233), N-His tagged | +Inquiry |
MCU-6098HF | Recombinant Full Length Human MCU Protein, GST-tagged | +Inquiry |
Mcu-2439M | Recombinant Mouse Mcu Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCU Products
Required fields are marked with *
My Review for All MCU Products
Required fields are marked with *