Recombinant Human MDK protein, GST-tagged
| Cat.No. : | MDK-440H |
| Product Overview : | Recombinant Human MDK protein(NP_001012333)(1-143 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-143 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | MDK midkine (neurite growth-promoting factor 2) [ Homo sapiens ] |
| Official Symbol | MDK |
| Synonyms | MDK; midkine (neurite growth-promoting factor 2); NEGF2; midkine; FLJ27379; MK; ARAP; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting protein; neurite outgrowth-promoting factor 2; |
| Gene ID | 4192 |
| mRNA Refseq | NM_001012333 |
| Protein Refseq | NP_001012333 |
| MIM | 162096 |
| UniProt ID | P21741 |
| ◆ Recombinant Proteins | ||
| MDK-5862H | Recombinant Human MDK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MDK-4526H | Recombinant Human MDK Protein (Ala22-Asp143), His tagged | +Inquiry |
| MDK-216H | Recombinant Human MDK Protein (Val21-Asp143), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| MDK-538H | Recombinant Human MDK protein | +Inquiry |
| Mdk-637R | Recombinant Rat Mdk protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MDK Products
Required fields are marked with *
My Review for All MDK Products
Required fields are marked with *
