Recombinant Human MEAF6 protein, GST-tagged

Cat.No. : MEAF6-5744H
Product Overview : Recombinant Human MEAF6 protein(1-191 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-191 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name MEAF6 MYST/Esa1-associated factor 6 [ Homo sapiens ]
Official Symbol MEAF6
Synonyms MEAF6; MYST/Esa1-associated factor 6; C1orf149, chromosome 1 open reading frame 149; chromatin modification-related protein MEAF6; CENP 28; centromere protein 28; Eaf6; Esa1p associated factor 6 homolog (S. cerevisiae); FLJ11730; NY SAR 91; hEAF6; protein EAF6 homolog; sarcoma antigen NY-SAR-91; esa1-associated factor 6 homolog; Esa1p-associated factor 6 homolog; CENP-28; C1orf149; CDABP0189; NY-SAR-91; RP3-423B22.2;
Gene ID 64769
mRNA Refseq NM_022756
Protein Refseq NP_073593
MIM 611001
UniProt ID Q9HAF1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MEAF6 Products

Required fields are marked with *

My Review for All MEAF6 Products

Required fields are marked with *

0
cart-icon
0
compare icon