Recombinant Human MEAF6 protein, GST-tagged

• Cat.No.: MEAF6-5744H
• Product Overview: Recombinant Human MEAF6 protein(1-191 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-191 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MEAF6 MYST/Esa1-associated factor 6 [ Homo sapiens ]
• Official Symbol: MEAF6
• Synonyms: MEAF6; MYST/Esa1-associated factor 6; C1orf149, chromosome 1 open reading frame 149; chromatin modification-related protein MEAF6; CENP 28; centromere protein 28; Eaf6; Esa1p associated factor 6 homolog (S. cerevisiae); FLJ11730; NY SAR 91; hEAF6; protein EAF6 homolog; sarcoma antigen NY-SAR-91; esa1-associated factor 6 homolog; Esa1p-associated factor 6 homolog; CENP-28; C1orf149; CDABP0189; NY-SAR-91; RP3-423B22.2
• Gene ID: 64769
• mRNA Refseq: NM_022756
• Protein Refseq: NP_073593
• MIM: 611001
• UniProt ID: Q9HAF1