Recombinant Human MECOM
Cat.No. : | MECOM-28333TH |
Product Overview : | Recombinant fragment of Human EVI1 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISH |
Gene Name | MECOM MDS1 and EVI1 complex locus [ Homo sapiens ] |
Official Symbol | MECOM |
Synonyms | MECOM; MDS1 and EVI1 complex locus; ecotropic viral integration site 1 , EVI1, MDS1, myelodysplasia syndrome 1; MDS1 and EVI1 complex locus protein EVI1; MDS1 EVI1; PRDM3; |
Gene ID | 2122 |
mRNA Refseq | NM_001105077 |
Protein Refseq | NP_001098547 |
MIM | 165215 |
Uniprot ID | Q03112 |
Chromosome Location | 3q26 |
Pathway | Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function | DNA binding; DNA binding; metal ion binding; protein binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
MECOM-6118HF | Recombinant Full Length Human MECOM Protein, GST-tagged | +Inquiry |
MECOM-4490H | Recombinant Human MECOM Protein, GST-tagged | +Inquiry |
MECOM-28333TH | Recombinant Human MECOM | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECOM-4396HCL | Recombinant Human MECOM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECOM Products
Required fields are marked with *
My Review for All MECOM Products
Required fields are marked with *