Recombinant Human MECOM

Cat.No. : MECOM-28333TH
Product Overview : Recombinant fragment of Human EVI1 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISH
Gene Name MECOM MDS1 and EVI1 complex locus [ Homo sapiens ]
Official Symbol MECOM
Synonyms MECOM; MDS1 and EVI1 complex locus; ecotropic viral integration site 1 , EVI1, MDS1, myelodysplasia syndrome 1; MDS1 and EVI1 complex locus protein EVI1; MDS1 EVI1; PRDM3;
Gene ID 2122
mRNA Refseq NM_001105077
Protein Refseq NP_001098547
MIM 165215
Uniprot ID Q03112
Chromosome Location 3q26
Pathway Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function DNA binding; DNA binding; metal ion binding; protein binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MECOM Products

Required fields are marked with *

My Review for All MECOM Products

Required fields are marked with *

0
cart-icon