Recombinant Human MECOM Protein, GST-tagged

Cat.No. : MECOM-4490H
Product Overview : Human MDS1 full-length ORF ( NP_004982.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
Molecular Mass : 45.1 kDa
AA Sequence : MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MECOM MDS1 and EVI1 complex locus [ Homo sapiens ]
Official Symbol MECOM
Synonyms MECOM; MDS1 and EVI1 complex locus; ecotropic viral integration site 1 , EVI1, MDS1, myelodysplasia syndrome 1; MDS1 and EVI1 complex locus protein EVI1; MDS1 EVI1; PRDM3; oncogene EVI1; zinc finger protein Evi1; AML1-EVI-1 fusion protein; MDS1 and EVI1 complex locus protein MDS1; myelodysplasia syndrome-associated protein 1; ecotropic virus integration site 1 protein homolog; EVI1; MDS1; MDS1-EVI1; AML1-EVI-1; MGC97004; MGC163392;
Gene ID 2122
mRNA Refseq NM_001105077
Protein Refseq NP_001098547
MIM 165215
UniProt ID Q03112

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MECOM Products

Required fields are marked with *

My Review for All MECOM Products

Required fields are marked with *

0
cart-icon
0
compare icon