Recombinant Human MECOM Protein, GST-tagged
Cat.No. : | MECOM-4490H |
Product Overview : | Human MDS1 full-length ORF ( NP_004982.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Mar 2011] |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MECOM MDS1 and EVI1 complex locus [ Homo sapiens ] |
Official Symbol | MECOM |
Synonyms | MECOM; MDS1 and EVI1 complex locus; ecotropic viral integration site 1 , EVI1, MDS1, myelodysplasia syndrome 1; MDS1 and EVI1 complex locus protein EVI1; MDS1 EVI1; PRDM3; oncogene EVI1; zinc finger protein Evi1; AML1-EVI-1 fusion protein; MDS1 and EVI1 complex locus protein MDS1; myelodysplasia syndrome-associated protein 1; ecotropic virus integration site 1 protein homolog; EVI1; MDS1; MDS1-EVI1; AML1-EVI-1; MGC97004; MGC163392; |
Gene ID | 2122 |
mRNA Refseq | NM_001105077 |
Protein Refseq | NP_001098547 |
MIM | 165215 |
UniProt ID | Q03112 |
◆ Recombinant Proteins | ||
MECOM-6118HF | Recombinant Full Length Human MECOM Protein, GST-tagged | +Inquiry |
MECOM-4490H | Recombinant Human MECOM Protein, GST-tagged | +Inquiry |
MECOM-28333TH | Recombinant Human MECOM | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECOM-4396HCL | Recombinant Human MECOM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECOM Products
Required fields are marked with *
My Review for All MECOM Products
Required fields are marked with *