Recombinant Human MED11 Protein, GST-tagged

Cat.No. : MED11-4480H
Product Overview : Human MED11 full-length ORF (AAH70377.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MED11 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM
Molecular Mass : 39.5 kDa
AA Sequence : MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED11 mediator complex subunit 11 [ Homo sapiens (human) ]
Official Symbol MED11
Synonyms MED11; mediator complex subunit 11; HSPC296; mediator of RNA polymerase II transcription subunit 11; mediator of RNA polymerase II transcription, subunit 11 homolog
Gene ID https://www.ncbi.nlm.nih.gov/gene/?term=400569
mRNA Refseq NM_001001683
Protein Refseq NP_001001683
MIM 612383
UniProt ID Q9P086

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED11 Products

Required fields are marked with *

My Review for All MED11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon