Recombinant Human MED19 Protein, GST-tagged
Cat.No. : | MED19-4474H |
Product Overview : | Human MED19 full-length ORF ( NP_703151.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MED19 mediator complex subunit 19 [ Homo sapiens ] |
Official Symbol | MED19 |
Synonyms | MED19; mediator complex subunit 19; mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 19; LCMR1; lung cancer metastasis-related protein 1; mediator of RNA polymerase II transcription, subunit 19 homolog; DT2P1G7; |
Gene ID | 219541 |
mRNA Refseq | NM_153450 |
Protein Refseq | NP_703151 |
MIM | 612385 |
UniProt ID | A0JLT2 |
◆ Recombinant Proteins | ||
MED19-6213HF | Recombinant Full Length Human MED19 Protein, GST-tagged | +Inquiry |
MED19-9691M | Recombinant Mouse MED19 Protein | +Inquiry |
MED19-362H | Recombinant Human MED19 Protein, His-tagged | +Inquiry |
MED19-5449M | Recombinant Mouse MED19 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED19-4474H | Recombinant Human MED19 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED19-4390HCL | Recombinant Human MED19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED19 Products
Required fields are marked with *
My Review for All MED19 Products
Required fields are marked with *