Recombinant Human MED19 Protein, GST-tagged

Cat.No. : MED19-4474H
Product Overview : Human MED19 full-length ORF ( NP_703151.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM
Molecular Mass : 46.8 kDa
AA Sequence : MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED19 mediator complex subunit 19 [ Homo sapiens ]
Official Symbol MED19
Synonyms MED19; mediator complex subunit 19; mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 19; LCMR1; lung cancer metastasis-related protein 1; mediator of RNA polymerase II transcription, subunit 19 homolog; DT2P1G7;
Gene ID 219541
mRNA Refseq NM_153450
Protein Refseq NP_703151
MIM 612385
UniProt ID A0JLT2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED19 Products

Required fields are marked with *

My Review for All MED19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon