Recombinant Human MED22 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MED22-1043H |
Product Overview : | MED22 MS Standard C13 and N15-labeled recombinant protein (NP_852468) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed. |
Molecular Mass : | 16.5 kDa |
AA Sequence : | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MED22 mediator complex subunit 22 [ Homo sapiens (human) ] |
Official Symbol | MED22 |
Synonyms | MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682; |
Gene ID | 6837 |
mRNA Refseq | NM_181491 |
Protein Refseq | NP_852468 |
MIM | 185641 |
UniProt ID | Q15528 |
◆ Recombinant Proteins | ||
MED22-3636R | Recombinant Rat MED22 Protein | +Inquiry |
MED22-808H | Recombinant Human MED22 protein, GST-tagged | +Inquiry |
MED22-9694M | Recombinant Mouse MED22 Protein | +Inquiry |
MED22-4473H | Recombinant Human MED22 Protein, GST-tagged | +Inquiry |
MED22-2721R | Recombinant Rhesus monkey MED22 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED22-4387HCL | Recombinant Human MED22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MED22 Products
Required fields are marked with *
My Review for All MED22 Products
Required fields are marked with *
0
Inquiry Basket