Recombinant Human MED26 Protein, GST-tagged
| Cat.No. : | MED26-1908H |
| Product Overview : | Human CRSP7 partial ORF ( NP_004822, 501 a.a. - 600 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MED26 mediator complex subunit 26 [ Homo sapiens ] |
| Official Symbol | MED26 |
| Synonyms | MED26; mediator complex subunit 26; cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa , CRSP7; mediator of RNA polymerase II transcription subunit 26; CRSP70; ARC70; CRSP complex subunit 7; transcriptional coactivator CRSP70; activator-recruited cofactor 70 kDa component; cofactor required for Sp1 transcriptional activation subunit 7; cofactor required for Sp1 transcriptional activation, subunit 7 (70kD); cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa; CRSP7; |
| Gene ID | 9441 |
| mRNA Refseq | NM_004831 |
| Protein Refseq | NP_004822 |
| MIM | 605043 |
| UniProt ID | O95402 |
| ◆ Recombinant Proteins | ||
| MED26-5454M | Recombinant Mouse MED26 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MED26-9698M | Recombinant Mouse MED26 Protein | +Inquiry |
| MED26-1908H | Recombinant Human MED26 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MED26-406HCL | Recombinant Human MED26 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED26 Products
Required fields are marked with *
My Review for All MED26 Products
Required fields are marked with *
