Recombinant Human MED26 Protein, GST-tagged

Cat.No. : MED26-1908H
Product Overview : Human CRSP7 partial ORF ( NP_004822, 501 a.a. - 600 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED26 mediator complex subunit 26 [ Homo sapiens ]
Official Symbol MED26
Synonyms MED26; mediator complex subunit 26; cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa , CRSP7; mediator of RNA polymerase II transcription subunit 26; CRSP70; ARC70; CRSP complex subunit 7; transcriptional coactivator CRSP70; activator-recruited cofactor 70 kDa component; cofactor required for Sp1 transcriptional activation subunit 7; cofactor required for Sp1 transcriptional activation, subunit 7 (70kD); cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa; CRSP7;
Gene ID 9441
mRNA Refseq NM_004831
Protein Refseq NP_004822
MIM 605043
UniProt ID O95402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED26 Products

Required fields are marked with *

My Review for All MED26 Products

Required fields are marked with *

0
cart-icon
0
compare icon