Recombinant Human MEF2B Protein, GST-tagged
Cat.No. : | MEF2B-4458H |
Product Overview : | Human MEF2B partial ORF (NP_005910.1, 165 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq |
Molecular Mass : | 33.44 kDa |
AA Sequence : | SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MEF2B myocyte enhancer factor 2B [ Homo sapiens ] |
Official Symbol | MEF2B |
Synonyms | MEF2B; myocyte enhancer factor 2B; myocyte-specific enhancer factor 2B; RSRFR2; serum response factor-like protein 2; MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B); FLJ32648; |
Gene ID | 100271849 |
mRNA Refseq | NM_001145785 |
Protein Refseq | NP_001139257 |
MIM | 600661 |
UniProt ID | Q02080 |
◆ Recombinant Proteins | ||
MEF2B-4458H | Recombinant Human MEF2B Protein, GST-tagged | +Inquiry |
MEF2B-8329Z | Recombinant Zebrafish MEF2B | +Inquiry |
Mef2b-4025M | Recombinant Mouse Mef2b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2B-1075HCL | Recombinant Human MEF2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MEF2B Products
Required fields are marked with *
My Review for All MEF2B Products
Required fields are marked with *
0
Inquiry Basket