Recombinant Human MEF2D protein, GST-tagged
| Cat.No. : | MEF2D-818H |
| Product Overview : | Recombinant Human MEF2D protein(165-514 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 165-514 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | TPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK |
| Gene Name | MEF2D myocyte enhancer factor 2D [ Homo sapiens ] |
| Official Symbol | MEF2D |
| Synonyms | MEF2D; myocyte enhancer factor 2D; myocyte-specific enhancer factor 2D; MEF2D/DAZAP1 fusion; MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancer factor 2D); myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusion protein; DKFZp686I1536; |
| Gene ID | 4209 |
| mRNA Refseq | NM_005920 |
| Protein Refseq | NP_005911 |
| MIM | 600663 |
| UniProt ID | Q14814 |
| ◆ Recombinant Proteins | ||
| MEF2D-1394H | Recombinant Human MEF2D Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mef2d-4027M | Recombinant Mouse Mef2d Protein, Myc/DDK-tagged | +Inquiry |
| MEF2D-598HFL | Recombinant Full Length Human MEF2D Protein | +Inquiry |
| MEF2D-818H | Recombinant Human MEF2D protein, GST-tagged | +Inquiry |
| MEF2D-3240C | Recombinant Chicken MEF2D | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MEF2D-4374HCL | Recombinant Human MEF2D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEF2D Products
Required fields are marked with *
My Review for All MEF2D Products
Required fields are marked with *


