Recombinant Human METTL7A Protein, GST-tagged
Cat.No. : | METTL7A-4399H |
Product Overview : | Human METTL7A full-length ORF ( NP_054752.3, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | METTL7A (Methyltransferase Like 7A) is a Protein Coding gene. Among its related pathways are Innate Immune System. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity. An important paralog of this gene is METTL7B. |
Molecular Mass : | 54.7 kDa |
AA Sequence : | MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL7A methyltransferase like 7A [ Homo sapiens ] |
Official Symbol | METTL7A |
Synonyms | METTL7A; methyltransferase like 7A; methyltransferase-like protein 7A; DKFZP586A0522; protein AAM-B; AAM-B; DKFZp586A0522; |
Gene ID | 25840 |
mRNA Refseq | NM_014033 |
Protein Refseq | NP_054752 |
UniProt ID | Q9H8H3 |
◆ Recombinant Proteins | ||
METTL7A-6177HF | Recombinant Full Length Human METTL7A Protein, GST-tagged | +Inquiry |
METTL7A-4399H | Recombinant Human METTL7A Protein, GST-tagged | +Inquiry |
METTL7A-2570R | Recombinant Rhesus Macaque METTL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL7A-973H | Recombinant Human METTL7A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL7A-1403H | Recombinant Human METTL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL7A-1085HCL | Recombinant Human METTL7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL7A Products
Required fields are marked with *
My Review for All METTL7A Products
Required fields are marked with *
0
Inquiry Basket