Recombinant Human METTL7A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | METTL7A-973H |
Product Overview : | METTL7A MS Standard C13 and N15-labeled recombinant protein (NP_054752) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Probable methyltransferase. |
Molecular Mass : | 28.3 kDa |
AA Sequence : | MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | METTL7A methyltransferase like 7A [ Homo sapiens (human) ] |
Official Symbol | METTL7A |
Synonyms | METTL7A; methyltransferase like 7A; methyltransferase-like protein 7A; DKFZP586A0522; protein AAM-B; AAM-B; DKFZp586A0522; |
Gene ID | 25840 |
mRNA Refseq | NM_014033 |
Protein Refseq | NP_054752 |
MIM | 618338 |
UniProt ID | Q9H8H3 |
◆ Recombinant Proteins | ||
METTL7A-973H | Recombinant Human METTL7A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL7A-849HFL | Recombinant Full Length Human METTL7A Protein, C-Flag-tagged | +Inquiry |
METTL7A-6177HF | Recombinant Full Length Human METTL7A Protein, GST-tagged | +Inquiry |
METTL7A-2749R | Recombinant Rhesus monkey METTL7A Protein, His-tagged | +Inquiry |
METTL7A-1403H | Recombinant Human METTL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL7A-1085HCL | Recombinant Human METTL7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL7A Products
Required fields are marked with *
My Review for All METTL7A Products
Required fields are marked with *
0
Inquiry Basket