Recombinant Human METTL7A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: METTL7A-973H
• Product Overview: METTL7A MS Standard C13 and N15-labeled recombinant protein (NP_054752) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Probable methyltransferase.
• Molecular Mass: 28.3 kDa
• AA Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: METTL7A methyltransferase like 7A [ Homo sapiens (human) ]
• Official Symbol: METTL7A
• Synonyms: METTL7A; methyltransferase like 7A; methyltransferase-like protein 7A; DKFZP586A0522; protein AAM-B; AAM-B; DKFZp586A0522
• Gene ID: 25840
• mRNA Refseq: NM_014033
• Protein Refseq: NP_054752
• MIM: 618338
• UniProt ID: Q9H8H3