Recombinant Human METTL7A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : METTL7A-973H
Product Overview : METTL7A MS Standard C13 and N15-labeled recombinant protein (NP_054752) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Probable methyltransferase.
Molecular Mass : 28.3 kDa
AA Sequence : MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name METTL7A methyltransferase like 7A [ Homo sapiens (human) ]
Official Symbol METTL7A
Synonyms METTL7A; methyltransferase like 7A; methyltransferase-like protein 7A; DKFZP586A0522; protein AAM-B; AAM-B; DKFZp586A0522;
Gene ID 25840
mRNA Refseq NM_014033
Protein Refseq NP_054752
MIM 618338
UniProt ID Q9H8H3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METTL7A Products

Required fields are marked with *

My Review for All METTL7A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon