Recombinant Human METTL9 Protein, GST-tagged
Cat.No. : | METTL9-4396H |
Product Overview : | Human METTL9 full-length ORF (BAC11356.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | METTL9 (Methyltransferase Like 9) is a Protein Coding gene. Diseases associated with METTL9 include Inflammatory Bowel Disease 1. GO annotations related to this gene include methyltransferase activity. |
Molecular Mass : | 62.8 kDa |
AA Sequence : | MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL9 methyltransferase like 9 [ Homo sapiens (human) ] |
Official Symbol | METTL9 |
Synonyms | METTL9; methyltransferase like 9; DREV; PAP1; DREV1; CGI-81; methyltransferase-like protein 9; CTB-31N19.3; DORA reverse strand protein 1; p53 activated protein 1 |
Gene ID | 51108 |
mRNA Refseq | NM_001077180 |
Protein Refseq | NP_001070648 |
MIM | 609388 |
UniProt ID | Q9H1A3 |
◆ Recombinant Proteins | ||
METTL9-215H | Recombinant Human METTL9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL9-1322C | Recombinant Chicken METTL9 | +Inquiry |
METTL9-5744H | Recombinant Human METTL9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL9-9769M | Recombinant Mouse METTL9 Protein | +Inquiry |
Mettl9-4052M | Recombinant Mouse Mettl9 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL9-4354HCL | Recombinant Human METTL9 293 Cell Lysate | +Inquiry |
METTL9-4355HCL | Recombinant Human METTL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL9 Products
Required fields are marked with *
My Review for All METTL9 Products
Required fields are marked with *