Recombinant Human MFAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MFAP2-1715H |
| Product Overview : | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002394) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. |
| Molecular Mass : | 20.83 kDa |
| AA Sequence : | MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MFAP2 microfibrillar-associated protein 2 [ Homo sapiens (human) ] |
| Official Symbol | MFAP2 |
| Synonyms | MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1; microfibril-associated glycoprotein 1; MAGP1; MAGP-1; FLJ50901; |
| Gene ID | 4237 |
| mRNA Refseq | NM_002403 |
| Protein Refseq | NP_002394 |
| MIM | 156790 |
| UniProt ID | P55001 |
| ◆ Recombinant Proteins | ||
| MFAP2-4392H | Recombinant Human MFAP2 Protein, GST-tagged | +Inquiry |
| MFAP2-3615Z | Recombinant Zebrafish MFAP2 | +Inquiry |
| MFAP2-4539H | Recombinant Human MFAP2 Protein (Leu6-Val162), His tagged | +Inquiry |
| MFAP2-343H | Active Recombinant Human MFAP2 protein, His-tagged | +Inquiry |
| MFAP2-30170TH | Recombinant Human MFAP2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MFAP2-4352HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
| MFAP2-4351HCL | Recombinant Human MFAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP2 Products
Required fields are marked with *
My Review for All MFAP2 Products
Required fields are marked with *



