Recombinant Human MFAP2

Cat.No. : MFAP2-30170TH
Product Overview : Recombinant fragment of Human MAGP1 with N-terminal proprietary tag. Predicted MW 34.76kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 83 amino acids
Description : Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene.
Molecular Weight : 34.760kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS
Sequence Similarities : Belongs to the MFAP family.Contains 1 SXC (ShKT) domain.
Gene Name MFAP2 microfibrillar-associated protein 2 [ Homo sapiens ]
Official Symbol MFAP2
Synonyms MFAP2; microfibrillar-associated protein 2; MAGP; MAGP 1;
Gene ID 4237
mRNA Refseq NM_001135247
Protein Refseq NP_001128719
MIM 156790
Uniprot ID P55001
Chromosome Location 1p36.1-p35
Pathway Notch signaling pathway, organism-specific biosystem;
Function fibrinogen binding; fibronectin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFAP2 Products

Required fields are marked with *

My Review for All MFAP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon