Recombinant Human MFAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MFAP5-3683H |
| Product Overview : | MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Protein Length : | 1-173 aa |
| Description : | This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 19.6 kDa |
| AA Sequence : | MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MFAP5 microfibrillar associated protein 5 [ Homo sapiens (human) ] |
| Official Symbol | MFAP5 |
| Synonyms | MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2; |
| Gene ID | 8076 |
| mRNA Refseq | NM_003480 |
| Protein Refseq | NP_003471 |
| MIM | 601103 |
| UniProt ID | Q13361 |
| ◆ Recombinant Proteins | ||
| MFAP5-5192H | Recombinant Human MFAP5 Protein (Leu24-Cys162), His tagged | +Inquiry |
| MFAP5-9780M | Recombinant Mouse MFAP5 Protein | +Inquiry |
| MFAP5-4437H | Recombinant Human MFAP5 protein, His-SUMO-tagged | +Inquiry |
| MFAP5-5512M | Recombinant Mouse MFAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MFAP5-3683H | Recombinant Human MFAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MFAP5-1395HCL | Recombinant Human MFAP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP5 Products
Required fields are marked with *
My Review for All MFAP5 Products
Required fields are marked with *



