Recombinant Human MFAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MFAP5-3683H
Product Overview : MFAP5 MS Standard C13 and N15-labeled recombinant protein (NP_003471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Protein Length : 1-173 aa
Description : This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 19.6 kDa
AA Sequence : MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MFAP5 microfibrillar associated protein 5 [ Homo sapiens (human) ]
Official Symbol MFAP5
Synonyms MFAP5; microfibrillar associated protein 5; microfibrillar-associated protein 5; MAGP2; MP25; MAGP-2; MFAP-5; microfibril-associated glycoprotein 2; microfibril-associated glycoprotein-2;
Gene ID 8076
mRNA Refseq NM_003480
Protein Refseq NP_003471
MIM 601103
UniProt ID Q13361

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFAP5 Products

Required fields are marked with *

My Review for All MFAP5 Products

Required fields are marked with *

0
cart-icon