Recombinant Human MFRP Protein, GST-tagged

• Cat.No.: MFRP-4377H
• Product Overview: Human MFRP partial ORF ( NP_113621, 480 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the frizzled-related proteins. The encoded protein may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mRNA, which also encodes C1q and tumor necrosis factor related protein 5
• Molecular Mass: 36.74 kDa
• AA Sequence: NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MFRP membrane frizzled-related protein [ Homo sapiens ]
• Official Symbol: MFRP
• Synonyms: MFRP; membrane frizzled-related protein; C1QTNF5; complement C1q tumor necrosis factor related protein 5 precursor variant 1; FLJ30570; membrane type frizzled related protein; NNO2; rd6; membrane-type frizzled-related protein; RD6; MCOP5; MGC32938; DKFZp586B0621
• Gene ID: 83552
• mRNA Refseq: NM_031433
• Protein Refseq: NP_113621
• MIM: 606227
• UniProt ID: Q9BY79