Recombinant Human MFRP Protein, GST-tagged
Cat.No. : | MFRP-4377H |
Product Overview : | Human MFRP partial ORF ( NP_113621, 480 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the frizzled-related proteins. The encoded protein may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mRNA, which also encodes C1q and tumor necrosis factor related protein 5 |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MFRP membrane frizzled-related protein [ Homo sapiens ] |
Official Symbol | MFRP |
Synonyms | MFRP; membrane frizzled-related protein; C1QTNF5; complement C1q tumor necrosis factor related protein 5 precursor variant 1; FLJ30570; membrane type frizzled related protein; NNO2; rd6; membrane-type frizzled-related protein; RD6; MCOP5; MGC32938; DKFZp586B0621; |
Gene ID | 83552 |
mRNA Refseq | NM_031433 |
Protein Refseq | NP_113621 |
MIM | 606227 |
UniProt ID | Q9BY79 |
◆ Recombinant Proteins | ||
MFRP-5518M | Recombinant Mouse MFRP Protein, His (Fc)-Avi-tagged | +Inquiry |
MFRP-4070H | Recombinant Human MFRP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFRP-9787M | Recombinant Mouse MFRP Protein | +Inquiry |
MFRP-4377H | Recombinant Human MFRP Protein, GST-tagged | +Inquiry |
MFRP-1249H | Recombinant Human MFRP Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
MFRP-001H | Recombinant Human MFRP Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFRP Products
Required fields are marked with *
My Review for All MFRP Products
Required fields are marked with *