Recombinant Human MFSD8 Protein (1-40 aa), His-GST-tagged

• Cat.No.: MFSD8-2165H
• Product Overview: Recombinant Human MFSD8 Protein (1-40 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Protein Description: Partial.

Specification

• Description: May be a carrier that transport small solutes by using chemiosmotic ion gradients.
• Source: E. coli
• Species: Human
• Tag: His-GST
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.8 kDa
• Protein length: 1-40 aa
• AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: MFSD8 major facilitator superfamily domain containing 8 [ Homo sapiens ]
• Official Symbol: MFSD8
• Synonyms: MFSD8; MGC33302; CLN7
• Gene ID: 256471
• mRNA Refseq: NM_152778
• Protein Refseq: NP_689991
• MIM: 611124
• UniProt ID: Q8NHS3