Recombinant Human MFSD8 Protein (1-40 aa), His-GST-tagged

Cat.No. : MFSD8-2165H
Product Overview : Recombinant Human MFSD8 Protein (1-40 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 1-40 aa
Description : May be a carrier that transport small solutes by using chemiosmotic ion gradients.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.8 kDa
AA Sequence : MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name MFSD8 major facilitator superfamily domain containing 8 [ Homo sapiens ]
Official Symbol MFSD8
Synonyms MFSD8; MGC33302; CLN7;
Gene ID 256471
mRNA Refseq NM_152778
Protein Refseq NP_689991
MIM 611124
UniProt ID Q8NHS3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFSD8 Products

Required fields are marked with *

My Review for All MFSD8 Products

Required fields are marked with *

0
cart-icon