Recombinant Human MFSD8 protein, His-tagged
Cat.No. : | MFSD8-3540H |
Product Overview : | Recombinant Human MFSD8 protein(351-421 aa), fused to His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 351-421 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFLT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MFSD8 major facilitator superfamily domain containing 8 [ Homo sapiens ] |
Official Symbol | MFSD8 |
Synonyms | MFSD8; major facilitator superfamily domain containing 8; ceroid lipofuscinosis, neuronal 7, late infantile, variant , CLN7; major facilitator superfamily domain-containing protein 8; MGC33302; ceroid-lipofuscinosis neuronal protein 7; ceroid-lipofuscinosis, neuronal 7, late infantile; CLN7; |
Gene ID | 256471 |
mRNA Refseq | NM_152778 |
Protein Refseq | NP_689991 |
MIM | 611124 |
UniProt ID | Q8NHS3 |
◆ Recombinant Proteins | ||
MFSD8-6166HF | Recombinant Full Length Human MFSD8 Protein, GST-tagged | +Inquiry |
MFSD8-5529M | Recombinant Mouse MFSD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFSD8-6204HF | Recombinant Full Length Human MFSD8 Protein | +Inquiry |
MFSD8-1039H | Recombinant Human MFSD8 | +Inquiry |
MFSD8-9802M | Recombinant Mouse MFSD8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFSD8-4344HCL | Recombinant Human MFSD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFSD8 Products
Required fields are marked with *
My Review for All MFSD8 Products
Required fields are marked with *