Recombinant Human MGP protein, T7/His-tagged
Cat.No. : | MGP-164H |
Product Overview : | Recombinant human MGP cDNA (20 - 96aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 20-96 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPV HELNREACDDYRLCERYAMVYGYNAAYNRYF |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | MGP matrix Gla protein [ Homo sapiens ] |
Official Symbol | MGP |
Synonyms | MGP; matrix Gla protein; cell growth-inhibiting gene 36 protein; NTI; GIG36; MGLAP; |
Gene ID | 4256 |
mRNA Refseq | NM_000900 |
Protein Refseq | NP_000891 |
MIM | 154870 |
UniProt ID | P08493 |
Chromosome Location | 12p12.3 |
Pathway | Endochondral Ossification, organism-specific biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem; |
Function | calcium ion binding; calcium-dependent protein binding; extracellular matrix structural constituent; structural constituent of bone; |
◆ Recombinant Proteins | ||
MGP-7010C | Recombinant Cattle MGP protein, His & GST-tagged | +Inquiry |
MGP-2596H | Recombinant Human MGP protein, His-tagged | +Inquiry |
MGP-3641H | Recombinant Human MGP, His-tagged | +Inquiry |
MGP-6519HF | Recombinant Full Length Human MGP Protein, GST-tagged | +Inquiry |
Mgp-7011M | Recombinant Mouse Mgp protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGP-4329HCL | Recombinant Human MGP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGP Products
Required fields are marked with *
My Review for All MGP Products
Required fields are marked with *
0
Inquiry Basket