Recombinant Human MGP protein, T7/His-tagged

Cat.No. : MGP-164H
Product Overview : Recombinant human MGP cDNA (20 - 96aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 20-96 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPV HELNREACDDYRLCERYAMVYGYNAAYNRYF
Purity : >90% by SDS-PAGE
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name MGP matrix Gla protein [ Homo sapiens ]
Official Symbol MGP
Synonyms MGP; matrix Gla protein; cell growth-inhibiting gene 36 protein; NTI; GIG36; MGLAP;
Gene ID 4256
mRNA Refseq NM_000900
Protein Refseq NP_000891
MIM 154870
UniProt ID P08493
Chromosome Location 12p12.3
Pathway Endochondral Ossification, organism-specific biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem;
Function calcium ion binding; calcium-dependent protein binding; extracellular matrix structural constituent; structural constituent of bone;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MGP Products

Required fields are marked with *

My Review for All MGP Products

Required fields are marked with *

0
cart-icon
0
compare icon