"MGP" Related Products

Expand
Expand
Expand

Recombinant Human MGP protein, T7/His-tagged

Cat.No.: MGP-164H
Product Overview: Recombinant human MGP cDNA (20 - 96aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPV HELNREACDDYRLCERYAMVYGYNAAYNRYF
Purity: >90% by SDS-PAGE
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: MGP matrix Gla protein [ Homo sapiens ]
Official Symbol: MGP
Synonyms: MGP; matrix Gla protein; cell growth-inhibiting gene 36 protein; NTI; GIG36; MGLAP;
Gene ID: 4256
mRNA Refseq: NM_000900
Protein Refseq: NP_000891
MIM: 154870
UniProt ID: P08493
Chromosome Location: 12p12.3
Pathway: Endochondral Ossification, organism-specific biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem;
Function: calcium ion binding; calcium-dependent protein binding; extracellular matrix structural constituent; structural constituent of bone;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.