Recombinant Human MGP protein, T7/His-tagged
| Cat.No. : | MGP-164H |
| Product Overview : | Recombinant human MGP cDNA (20 - 96aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 20-96 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPV HELNREACDDYRLCERYAMVYGYNAAYNRYF |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | MGP matrix Gla protein [ Homo sapiens ] |
| Official Symbol | MGP |
| Synonyms | MGP; matrix Gla protein; cell growth-inhibiting gene 36 protein; NTI; GIG36; MGLAP; |
| Gene ID | 4256 |
| mRNA Refseq | NM_000900 |
| Protein Refseq | NP_000891 |
| MIM | 154870 |
| UniProt ID | P08493 |
| Chromosome Location | 12p12.3 |
| Pathway | Endochondral Ossification, organism-specific biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem; |
| Function | calcium ion binding; calcium-dependent protein binding; extracellular matrix structural constituent; structural constituent of bone; |
| ◆ Recombinant Proteins | ||
| MGP-5542M | Recombinant Mouse MGP Protein, His (Fc)-Avi-tagged | +Inquiry |
| MGP-5306H | Recombinant Human MGP Protein, GST-tagged | +Inquiry |
| MGP-2765R | Recombinant Rhesus monkey MGP Protein, His-tagged | +Inquiry |
| MGP-164H | Recombinant Human MGP protein, T7/His-tagged | +Inquiry |
| Mgp-7014R | Recombinant Rat Mgp protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MGP-4329HCL | Recombinant Human MGP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGP Products
Required fields are marked with *
My Review for All MGP Products
Required fields are marked with *
