Recombinant Human MICA protein
Cat.No. : | MICA-1280H |
Product Overview : | Recombinant Human MICA protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 320 |
Description : | MIC-A (MHC class I chain-related gene A) is a single-pass type I member protein. It is expressed on the cell surface in gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm in keratinocytes and monocytes. Additionally, MIC-A can be induced by bacterial and viral infections. It shares 85 % amino acid identity with MIC-B and they are distantly related to the MHC class I proteins. Because they possess three extracellular Ig-like domains, but unlike classical MHC class I molecules. They do not form a heterodimer with beta2 microglobulin, but bind as a monomer to a KLRK1/NKG2D that is an activating receptor expressed on NK cells, NKT cells, γδ T cells, and CD8+ αβ T cells. Recognition of MICA by NKG2D results in the activation of cytolytic activity and/or cytokine production by these effector cells. MIC-A recognition plays an important role in tumor surveillance, viral infections, and autoimmune diseases. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, and 8 M Urea. |
Bio-activity : | Fully biologically active when compared to standard. The specific activity is determined by binding MICA antibody in ELISA. |
Molecular Mass : | Approximately 36.9 kDa, a single non-glycosylated polypeptide chain containing 320 amino acids. |
AA Sequence : | MSYYHHHHHHDYDIPTTENLYFQGAMDPEFEPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHKLGCFGG |
Endotoxin : | Less than 1 EU/µg of rHuMIC-A, His as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions, which contain 8 M Urea. |
Gene Name | MICA |
Official Symbol | MICA |
Synonyms | MICA; MHC class I polypeptide-related sequence A; PERB11.1; HLA class I antigen; stress inducible class I homolog; MHC class I chain-related protein A; MIC-A; FLJ36918; FLJ60820; MGC21250; MGC111087; |
Gene ID | 100507436 |
mRNA Refseq | NM_000247 |
Protein Refseq | NP_000238 |
MIM | 600169 |
UniProt ID | Q29983 |
◆ Recombinant Proteins | ||
MICA-746HFL | Recombinant Full Length Human MICA Protein, C-Flag-tagged | +Inquiry |
MICA-1660C | Recombinant Cynomolgus MICA protein, His-tagged | +Inquiry |
MICA-823H | Recombinant Human MICA Protein | +Inquiry |
MICA-1232H | Recombinant Human MICA Protein, Fc-tagged | +Inquiry |
MICA-6630H | Recombinant Human MICA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MICA-1941HCL | Recombinant Human MICA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MICA Products
Required fields are marked with *
My Review for All MICA Products
Required fields are marked with *
0
Inquiry Basket