| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
320 |
| Description : |
MIC-A (MHC class I chain-related gene A) is a single-pass type I member protein. It is expressed on the cell surface in gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm in keratinocytes and monocytes. Additionally, MIC-A can be induced by bacterial and viral infections. It shares 85 % amino acid identity with MIC-B and they are distantly related to the MHC class I proteins. Because they possess three extracellular Ig-like domains, but unlike classical MHC class I molecules. They do not form a heterodimer with beta2 microglobulin, but bind as a monomer to a KLRK1/NKG2D that is an activating receptor expressed on NK cells, NKT cells, γδ T cells, and CD8+ αβ T cells. Recognition of MICA by NKG2D results in the activation of cytolytic activity and/or cytokine production by these effector cells. MIC-A recognition plays an important role in tumor surveillance, viral infections, and autoimmune diseases. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, and 8 M Urea. |
| Bio-activity : |
Fully biologically active when compared to standard. The specific activity is determined by binding MICA antibody in ELISA. |
| Molecular Mass : |
Approximately 36.9 kDa, a single non-glycosylated polypeptide chain containing 320 amino acids. |
| AA Sequence : |
MSYYHHHHHHDYDIPTTENLYFQGAMDPEFEPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHKLGCFGG |
| Endotoxin : |
Less than 1 EU/µg of rHuMIC-A, His as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions, which contain 8 M Urea. |