Recombinant Human MICAL2 Protein, GST-tagged

• Cat.No.: MICAL2-5322H
• Product Overview: Human MICAL2 partial ORF ( NP_055447.1, 1021 a.a. - 1123 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a monooxygenase that enhances depolymerization of F-actin and is therefore involved in cytoskeletal dynamics. The encoded protein is a regulator of the SRF signaling pathway. Increased expression of this gene has been associated with cancer progression and metastasis. [provided by RefSeq, Oct 2016]
• Molecular Mass: 37.07 kDa
• AA Sequence: FFHRECFRCSICATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MICAL2 microtubule associated monoxygenase, calponin and LIM domain containing 2 [ Homo sapiens ]
• Official Symbol: MICAL2
• Synonyms: MICAL2; microtubule associated monoxygenase, calponin and LIM domain containing 2; protein-methionine sulfoxide oxidase MICAL2; KIAA0750; protein MICAL-2; flavoprotein oxidoreductase MICAL2; molecule interacting with CasL protein 2; MICAL-2; MICAL2PV1; MICAL2PV2; DKFZp686H2469; DKFZp686H03148
• Gene ID: 9645
• mRNA Refseq: NM_014632
• Protein Refseq: NP_055447
• MIM: 608881
• UniProt ID: O94851