Recombinant Human MICAL2 Protein, GST-tagged

Cat.No. : MICAL2-5322H
Product Overview : Human MICAL2 partial ORF ( NP_055447.1, 1021 a.a. - 1123 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a monooxygenase that enhances depolymerization of F-actin and is therefore involved in cytoskeletal dynamics. The encoded protein is a regulator of the SRF signaling pathway. Increased expression of this gene has been associated with cancer progression and metastasis. [provided by RefSeq, Oct 2016]
Molecular Mass : 37.07 kDa
AA Sequence : FFHRECFRCSICATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MICAL2 microtubule associated monoxygenase, calponin and LIM domain containing 2 [ Homo sapiens ]
Official Symbol MICAL2
Synonyms MICAL2; microtubule associated monoxygenase, calponin and LIM domain containing 2; protein-methionine sulfoxide oxidase MICAL2; KIAA0750; protein MICAL-2; flavoprotein oxidoreductase MICAL2; molecule interacting with CasL protein 2; MICAL-2; MICAL2PV1; MICAL2PV2; DKFZp686H2469; DKFZp686H03148;
Gene ID 9645
mRNA Refseq NM_014632
Protein Refseq NP_055447
MIM 608881
UniProt ID O94851

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MICAL2 Products

Required fields are marked with *

My Review for All MICAL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon