Recombinant Human MICAL2 Protein, GST-tagged
Cat.No. : | MICAL2-5322H |
Product Overview : | Human MICAL2 partial ORF ( NP_055447.1, 1021 a.a. - 1123 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a monooxygenase that enhances depolymerization of F-actin and is therefore involved in cytoskeletal dynamics. The encoded protein is a regulator of the SRF signaling pathway. Increased expression of this gene has been associated with cancer progression and metastasis. [provided by RefSeq, Oct 2016] |
Molecular Mass : | 37.07 kDa |
AA Sequence : | FFHRECFRCSICATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MICAL2 microtubule associated monoxygenase, calponin and LIM domain containing 2 [ Homo sapiens ] |
Official Symbol | MICAL2 |
Synonyms | MICAL2; microtubule associated monoxygenase, calponin and LIM domain containing 2; protein-methionine sulfoxide oxidase MICAL2; KIAA0750; protein MICAL-2; flavoprotein oxidoreductase MICAL2; molecule interacting with CasL protein 2; MICAL-2; MICAL2PV1; MICAL2PV2; DKFZp686H2469; DKFZp686H03148; |
Gene ID | 9645 |
mRNA Refseq | NM_014632 |
Protein Refseq | NP_055447 |
MIM | 608881 |
UniProt ID | O94851 |
◆ Recombinant Proteins | ||
MICAL2-3679R | Recombinant Rat MICAL2 Protein | +Inquiry |
MICAL2-2441H | Recombinant Human MICAL2 Protein, His-tagged | +Inquiry |
MICAL2-1455H | Recombinant Human MICAL2 Protein (1-495 aa), His-tagged | +Inquiry |
MICAL2-9827M | Recombinant Mouse MICAL2 Protein | +Inquiry |
MICAL2-3335R | Recombinant Rat MICAL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MICAL2 Products
Required fields are marked with *
My Review for All MICAL2 Products
Required fields are marked with *