Recombinant Human MICB Protein, GST-tagged
| Cat.No. : | MICB-5326H |
| Product Overview : | Human MICB full-length ORF ( AAH44218.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the receptor. This protein is stress-induced and is similar to MHC class I molecules; however, it does not associate with beta-2-microglobulin or bind peptides. [provided by RefSeq |
| Molecular Mass : | 64 kDa |
| AA Sequence : | MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MICB MHC class I polypeptide-related sequence B [ Homo sapiens ] |
| Official Symbol | MICB |
| Synonyms | MICB; MHC class I polypeptide-related sequence B; PERB11.2; MIC-B; MHC class I mic-B antigen; stress inducible class I homolog; MHC class I chain-related protein B; MHC class I-like molecule PERB11.2-IMX; |
| Gene ID | 4277 |
| mRNA Refseq | NM_005931 |
| Protein Refseq | NP_005922 |
| MIM | 602436 |
| UniProt ID | Q29980 |
| ◆ Recombinant Proteins | ||
| MICB-5326H | Recombinant Human MICB Protein, GST-tagged | +Inquiry |
| MICB-1395H | Recombinant Human MICB protein, hFc-tagged | +Inquiry |
| MICB-203H | Recombinant Human MICB Protein, His (Fc)-Avi-tagged | +Inquiry |
| MICB-980H | Recombinant Human MICB protein, His-Avi-tagged | +Inquiry |
| MICB-247H | Recombinant Human MHC class I polypeptide-related sequence B Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MICB-2885HCL | Recombinant Human MICB cell lysate | +Inquiry |
| MICB-2712HCL | Recombinant Human MICB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MICB Products
Required fields are marked with *
My Review for All MICB Products
Required fields are marked with *
