"MICB" Related Products

Expand
Expand

Recombinant Human MICB Protein, GST-tagged

Cat.No. : MICB-5326H
Product Overview : Human MICB full-length ORF ( AAH44218.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the receptor. This protein is stress-induced and is similar to MHC class I molecules; however, it does not associate with beta-2-microglobulin or bind peptides. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 64 kDa
AA Sequence : MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : MICB MHC class I polypeptide-related sequence B [ Homo sapiens ]
Official Symbol : MICB
Synonyms : MICB; MHC class I polypeptide-related sequence B; PERB11.2; MIC-B; MHC class I mic-B antigen; stress inducible class I homolog; MHC class I chain-related protein B; MHC class I-like molecule PERB11.2-IMX;
Gene ID : 4277
mRNA Refseq : NM_005931
Protein Refseq : NP_005922
MIM : 602436
UniProt ID : Q29980

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.