Recombinant Human MIEF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MIEF1-4502H
Product Overview : SMCR7L MS Standard C13 and N15-labeled recombinant protein (NP_061881) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MIEF1 (Mitochondrial Elongation Factor 1) is a Protein Coding gene. Diseases associated with MIEF1 include Optic Atrophy 1 and Encephalopathy Due To Defective Mitochondrial And Peroxisomal Fission 1. Gene Ontology (GO) annotations related to this gene include identical protein binding and ADP binding. An important paralog of this gene is MIEF2.
Molecular Mass : 51.3 kDa
AA Sequence : MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MIEF1 mitochondrial elongation factor 1 [ Homo sapiens (human) ]
Official Symbol MIEF1
Synonyms MIEF1; mitochondrial elongation factor 1; MID51; SMCR7L; AltMIEF1; HSU79252; MIEF1-MP; dJ1104E15.3; mitochondrial dynamics protein MID51; MIEF1 microprotein; SMCR7-like protein; Smith-Magenis syndrome chromosome region, candidate 7-like; alternative MIEF1 protein; mitochondrial dynamic protein MID51; mitochondrial dynamic protein of 51 kDa; mitochondrial dynamics protein of 51 kDa; smith-Magenis syndrome chromosomal region candidate gene 7 protein-like
Gene ID 54471
mRNA Refseq NM_019008
Protein Refseq NP_061881
MIM 615497
UniProt ID Q9NQG6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIEF1 Products

Required fields are marked with *

My Review for All MIEF1 Products

Required fields are marked with *

0
cart-icon