Recombinant Human MIEF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MIEF1-4502H |
| Product Overview : | SMCR7L MS Standard C13 and N15-labeled recombinant protein (NP_061881) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | MIEF1 (Mitochondrial Elongation Factor 1) is a Protein Coding gene. Diseases associated with MIEF1 include Optic Atrophy 1 and Encephalopathy Due To Defective Mitochondrial And Peroxisomal Fission 1. Gene Ontology (GO) annotations related to this gene include identical protein binding and ADP binding. An important paralog of this gene is MIEF2. |
| Molecular Mass : | 51.3 kDa |
| AA Sequence : | MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MIEF1 mitochondrial elongation factor 1 [ Homo sapiens (human) ] |
| Official Symbol | MIEF1 |
| Synonyms | MIEF1; mitochondrial elongation factor 1; MID51; SMCR7L; AltMIEF1; HSU79252; MIEF1-MP; dJ1104E15.3; mitochondrial dynamics protein MID51; MIEF1 microprotein; SMCR7-like protein; Smith-Magenis syndrome chromosome region, candidate 7-like; alternative MIEF1 protein; mitochondrial dynamic protein MID51; mitochondrial dynamic protein of 51 kDa; mitochondrial dynamics protein of 51 kDa; smith-Magenis syndrome chromosomal region candidate gene 7 protein-like |
| Gene ID | 54471 |
| mRNA Refseq | NM_019008 |
| Protein Refseq | NP_061881 |
| MIM | 615497 |
| UniProt ID | Q9NQG6 |
| ◆ Recombinant Proteins | ||
| MIEF1-5456Z | Recombinant Zebrafish MIEF1 | +Inquiry |
| MIEF1-4502H | Recombinant Human MIEF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Mief1-4071M | Recombinant Mouse Mief1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIEF1-1663HCL | Recombinant Human SMCR7L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIEF1 Products
Required fields are marked with *
My Review for All MIEF1 Products
Required fields are marked with *
