Recombinant Human MIF protein, His&Myc-tagged
| Cat.No. : | MIF-3224H |
| Product Overview : | Recombinant Human MIF protein(P14174)(2-115aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-115aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.1 kDa |
| AA Sequence : | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ] |
| Official Symbol | MIF |
| Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
| Gene ID | 4282 |
| mRNA Refseq | NM_002415 |
| Protein Refseq | NP_002406 |
| MIM | 153620 |
| UniProt ID | P14174 |
| ◆ Recombinant Proteins | ||
| Mif-4073M | Recombinant Mouse Mif Protein, Myc/DDK-tagged | +Inquiry |
| Mif-125M | Recombinant Mouse Mif Protein, His-tagged | +Inquiry |
| MIF-23H | Recombinant Human MIF protein, His-tagged | +Inquiry |
| MIF-0503H | Recombinant Human MIF protein, His-Avi-tagged, Biotinylated | +Inquiry |
| Mif-676R | Recombinant Rat Mif protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
| MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *
