Recombinant Human MIF protein, His&Myc-tagged
Cat.No. : | MIF-3224H |
Product Overview : | Recombinant Human MIF protein(P14174)(2-115aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-115aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ] |
Official Symbol | MIF |
Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
Gene ID | 4282 |
mRNA Refseq | NM_002415 |
Protein Refseq | NP_002406 |
MIM | 153620 |
UniProt ID | P14174 |
◆ Recombinant Proteins | ||
Mif-7286M | Recombinant Mouse Mif Protein, His-tagged | +Inquiry |
MIF-198H | Recombinant Human MIF protein | +Inquiry |
MIF-5464H | Recombinant Human MIF protein, His-tagged | +Inquiry |
MIF-650H | Active Recombinant Human MIF, His-tagged | +Inquiry |
MIF-09H | Active Recombinant Human MIF | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *