Recombinant Human MLF1IP Protein, GST-tagged
Cat.No. : | MLF1IP-5383H |
Product Overview : | Human MLF1IP full-length ORF ( AAH31520, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). MLF1IP, or CENPU, is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).[supplied by OMIM |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MLF1IP MLF1 interacting protein [ Homo sapiens ] |
Official Symbol | MLF1IP |
Synonyms | CENPU; KLIP1; PBIP1; CENP50; CENPU50 |
Gene ID | 79682 |
mRNA Refseq | NM_024629 |
Protein Refseq | NP_078905 |
MIM | 611511 |
UniProt ID | Q71F23 |
◆ Recombinant Proteins | ||
MLF1IP-5579M | Recombinant Mouse MLF1IP Protein, His (Fc)-Avi-tagged | +Inquiry |
MLF1IP-9875M | Recombinant Mouse MLF1IP Protein | +Inquiry |
MLF1IP-7877H | Recombinant Human MLF1IP protein, His-tagged | +Inquiry |
MLF1IP-3700R | Recombinant Rat MLF1IP Protein | +Inquiry |
MLF1IP-1060H | Recombinant Human MLF1IP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLF1IP Products
Required fields are marked with *
My Review for All MLF1IP Products
Required fields are marked with *