"MLF1IP" Related Products

Expand

Recombinant Human MLF1IP Protein, GST-tagged

Cat.No. : MLF1IP-5383H
Product Overview : Human MLF1IP full-length ORF ( AAH31520, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). MLF1IP, or CENPU, is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).[supplied by OMIM
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 45.1 kDa
AA Sequence : MKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : MLF1IP MLF1 interacting protein [ Homo sapiens ]
Official Symbol : MLF1IP
Synonyms : CENPU; KLIP1; PBIP1; CENP50; CENPU50
Gene ID : 79682
mRNA Refseq : NM_024629
Protein Refseq : NP_078905
MIM : 611511
UniProt ID : Q71F23

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.