Recombinant Human MMP1 protein, T7/His-tagged
Cat.No. : | MMP1-91H |
Product Overview : | Recombinant human MMP1 cDNA (100 – 469 aa, derived from BC013875), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 100-469 a.a. |
Form : | 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVT PLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHEL GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVM FFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGF PRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQY KFDPKTKRILTLQKANSWFNCRKN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro activated MMP1 mediated extracellular matrix protein signal regulation study for various cell differentiation regulation with this protein as either coating matrix protein or soluble factor.2. May be used as MMP1 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential cancer diagnostic biomarker protein.5. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ] |
Official Symbol | MMP1 |
Synonyms | MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN; |
Gene ID | 4312 |
mRNA Refseq | NM_001145938 |
Protein Refseq | NP_001139410 |
MIM | 120353 |
UniProt ID | P03956 |
Chromosome Location | 11q21-q22 |
Pathway | Activation of Matrix Metalloproteinases, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem |
Function | calcium ion binding; metalloendopeptidase activity; peptidase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
MMP1-245H | Recombinant Human matrix metallopeptidase 1 Protein, Flag tagged | +Inquiry |
MMP1-1116P | Recombinant Pig MMP1 Protein, His-tagged | +Inquiry |
MMP1-4561H | Recombinant Human MMP1 Protein (Phe20-Asn469), N-His tagged | +Inquiry |
MMP1-724C | Recombinant Cattle MMP1 protein, His & T7-tagged | +Inquiry |
MMP1-445H | Recombinant Human matrix metallopeptidase 1 (interstitial collagenase), His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP1-45H | Native Human MMP-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP1-2884HCL | Recombinant Human MMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP1 Products
Required fields are marked with *
My Review for All MMP1 Products
Required fields are marked with *
0
Inquiry Basket