Recombinant Human MMP1 protein, T7/His-tagged

Cat.No. : MMP1-91H
Product Overview : Recombinant human MMP1 cDNA (100 – 469 aa, derived from BC013875), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 100-469 a.a.
Form : 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVT PLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHEL GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVM FFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGF PRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQY KFDPKTKRILTLQKANSWFNCRKN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro activated MMP1 mediated extracellular matrix protein signal regulation study for various cell differentiation regulation with this protein as either coating matrix protein or soluble factor.2. May be used as MMP1 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As potential cancer diagnostic biomarker protein.5. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ]
Official Symbol MMP1
Synonyms MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN;
Gene ID 4312
mRNA Refseq NM_001145938
Protein Refseq NP_001139410
MIM 120353
UniProt ID P03956
Chromosome Location 11q21-q22
Pathway Activation of Matrix Metalloproteinases, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem
Function calcium ion binding; metalloendopeptidase activity; peptidase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMP1 Products

Required fields are marked with *

My Review for All MMP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon