Recombinant Human MMP14 protein, His-SUMO-tagged
| Cat.No. : | MMP14-3233H |
| Product Overview : | Recombinant Human MMP14 protein(P50281)(112-582aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 112-582aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 69.9 kDa |
| AA Sequence : | YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MMP14 matrix metallopeptidase 14 (membrane-inserted) [ Homo sapiens ] |
| Official Symbol | MMP14 |
| Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane inserted); matrix metalloproteinase-14; membrane type 1 metalloprotease; MT1 MMP; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); 1; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; MT1-MMP; MT-MMP 1; |
| Gene ID | 4323 |
| mRNA Refseq | NM_004995 |
| Protein Refseq | NP_004986 |
| MIM | 600754 |
| UniProt ID | P50281 |
| ◆ Recombinant Proteins | ||
| MMP14-3296R | Recombinant Rhesus monkey MMP14 protein, His-tagged | +Inquiry |
| MMP14-2790R | Recombinant Rhesus monkey MMP14 Protein, His-tagged | +Inquiry |
| MMP14-3649H | Recombinant Human MMP14 protein, His-tagged | +Inquiry |
| MMP14-33H | Active Recombinant Human MMP14 protein, mutation C127S, No Activation Required | +Inquiry |
| MMP14-3233H | Recombinant Human MMP14 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP14-243HKCL | Human MMP14 Knockdown Cell Lysate | +Inquiry |
| MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP14 Products
Required fields are marked with *
My Review for All MMP14 Products
Required fields are marked with *
