Recombinant Human MMP16 protein, His-tagged
Cat.No. : | MMP16-712H |
Product Overview : | Recombinant Human MMP16 protein(NP_005932)(33-400 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 33-400 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | TVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MMP16 matrix metallopeptidase 16 (membrane-inserted) [ Homo sapiens ] |
Official Symbol | MMP16 |
Synonyms | MMP16; matrix metallopeptidase 16 (membrane-inserted); C8orf57, chromosome 8 open reading frame 57 , matrix metalloproteinase 16 (membrane inserted); matrix metalloproteinase-16; DKFZp761D112; MT3 MMP; MMP-16; MT3MMP; MTMMP3; MT-MMP 3; Putative transmembrane protein C8orf57; membrane-type matrix metalloproteinase 3; membrane-type-3 matrix metalloproteinase; MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP; |
Gene ID | 4325 |
mRNA Refseq | NM_005941 |
Protein Refseq | NP_005932 |
MIM | 602262 |
UniProt ID | P51512 |
◆ Recombinant Proteins | ||
RFL7251RF | Recombinant Full Length Rat Matrix Metalloproteinase-16(Mmp16) Protein, His-Tagged | +Inquiry |
RFL25871HF | Recombinant Full Length Human Matrix Metalloproteinase-16(Mmp16) Protein, His-Tagged | +Inquiry |
MMP16-7089H | Recombinant Human MMP16 protein, His & T7-tagged | +Inquiry |
MMP16-3370R | Recombinant Rat MMP16 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP16-3714R | Recombinant Rat MMP16 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP16 Products
Required fields are marked with *
My Review for All MMP16 Products
Required fields are marked with *