Recombinant Human MMP16 protein, His-tagged

• Cat.No.: MMP16-712H
• Product Overview: Recombinant Human MMP16 protein(NP_005932)(33-400 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 33-400 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: TVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MMP16 matrix metallopeptidase 16 (membrane-inserted) [ Homo sapiens ]
• Official Symbol: MMP16
• Synonyms: MMP16; matrix metallopeptidase 16 (membrane-inserted); C8orf57, chromosome 8 open reading frame 57 , matrix metalloproteinase 16 (membrane inserted); matrix metalloproteinase-16; DKFZp761D112; MT3 MMP; MMP-16; MT3MMP; MTMMP3; MT-MMP 3; Putative transmembrane protein C8orf57; membrane-type matrix metalloproteinase 3; membrane-type-3 matrix metalloproteinase; MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP
• Gene ID: 4325
• mRNA Refseq: NM_005941
• Protein Refseq: NP_005932
• MIM: 602262
• UniProt ID: P51512