Recombinant Human MMP16 protein, His-tagged
| Cat.No. : | MMP16-712H |
| Product Overview : | Recombinant Human MMP16 protein(NP_005932)(33-400 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 33-400 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | TVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MMP16 matrix metallopeptidase 16 (membrane-inserted) [ Homo sapiens ] |
| Official Symbol | MMP16 |
| Synonyms | MMP16; matrix metallopeptidase 16 (membrane-inserted); C8orf57, chromosome 8 open reading frame 57 , matrix metalloproteinase 16 (membrane inserted); matrix metalloproteinase-16; DKFZp761D112; MT3 MMP; MMP-16; MT3MMP; MTMMP3; MT-MMP 3; Putative transmembrane protein C8orf57; membrane-type matrix metalloproteinase 3; membrane-type-3 matrix metalloproteinase; MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP; |
| Gene ID | 4325 |
| mRNA Refseq | NM_005941 |
| Protein Refseq | NP_005932 |
| MIM | 602262 |
| UniProt ID | P51512 |
| ◆ Recombinant Proteins | ||
| MMP16-3714R | Recombinant Rat MMP16 Protein | +Inquiry |
| MMP16-7089H | Recombinant Human MMP16 protein, His & T7-tagged | +Inquiry |
| MMP16-3370R | Recombinant Rat MMP16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MMP16-608H | Recombinant Human MMP16, Catalytic Domain | +Inquiry |
| MMP16-712H | Recombinant Human MMP16 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP16 Products
Required fields are marked with *
My Review for All MMP16 Products
Required fields are marked with *



