Recombinant Human MMP19 protein, His-tagged
| Cat.No. : | MMP19-3405H |
| Product Overview : | Recombinant Human MMP19 protein(207-508 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 207-508 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MMP19 matrix metallopeptidase 19 [ Homo sapiens ] |
| Official Symbol | MMP19 |
| Synonyms | MMP19; matrix metallopeptidase 19; matrix metalloproteinase 19 , MMP18; matrix metalloproteinase-19; RASI 1; MMP-18; MMP-19; matrix metalloproteinase 18; matrix metalloproteinase 19; matrix metalloproteinase-18; matrix metalloproteinase RASI; MMP18; RASI-1; |
| Gene ID | 4327 |
| mRNA Refseq | NM_002429 |
| Protein Refseq | NP_002420 |
| MIM | 601807 |
| UniProt ID | Q99542 |
| ◆ Recombinant Proteins | ||
| MMP19-6465HF | Recombinant Full Length Human MMP19 Protein, GST-tagged | +Inquiry |
| MMP19-3405H | Recombinant Human MMP19 protein, His-tagged | +Inquiry |
| Mmp19-4099M | Recombinant Mouse Mmp19 Protein, Myc/DDK-tagged | +Inquiry |
| MMP19-161H | Active Recombinant Human MMP19 protein, Catalytic Domain No Activation Required | +Inquiry |
| MMP19-018H | Recombinant Hamster Matrix metalloproteinase 19 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP19-4277HCL | Recombinant Human MMP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP19 Products
Required fields are marked with *
My Review for All MMP19 Products
Required fields are marked with *
