Recombinant Human MMP19 protein, His-tagged
Cat.No. : | MMP19-3405H |
Product Overview : | Recombinant Human MMP19 protein(207-508 aa), fused to His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 207-508 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MMP19 matrix metallopeptidase 19 [ Homo sapiens ] |
Official Symbol | MMP19 |
Synonyms | MMP19; matrix metallopeptidase 19; matrix metalloproteinase 19 , MMP18; matrix metalloproteinase-19; RASI 1; MMP-18; MMP-19; matrix metalloproteinase 18; matrix metalloproteinase 19; matrix metalloproteinase-18; matrix metalloproteinase RASI; MMP18; RASI-1; |
Gene ID | 4327 |
mRNA Refseq | NM_002429 |
Protein Refseq | NP_002420 |
MIM | 601807 |
UniProt ID | Q99542 |
◆ Recombinant Proteins | ||
Mmp19-4099M | Recombinant Mouse Mmp19 Protein, Myc/DDK-tagged | +Inquiry |
MMP19-161H | Recombinant Human MMP19, Catalytic Domain | +Inquiry |
MMP19-4580H | Recombinant Human MMP19 Protein (Tyr98-Tyr508), N-His tagged | +Inquiry |
MMP19-7378H | Recombinant Human MMP19 protein(Leu101-Gly256) | +Inquiry |
MMP19-182H | Recombinant Human MMP19 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP19-4277HCL | Recombinant Human MMP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP19 Products
Required fields are marked with *
My Review for All MMP19 Products
Required fields are marked with *