Recombinant Human MMP7 Protein, GST-tagged
| Cat.No. : | MMP7-395H |
| Product Overview : | Recombinant Human MMP7 Protien(NP_002414)(1-100 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-100 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | MMP7 matrix metallopeptidase 7 (matrilysin, uterine) [ Homo sapiens ] |
| Official Symbol | MMP7 |
| Synonyms | MMP7; matrix metallopeptidase 7 (matrilysin, uterine); matrix metalloproteinase 7 (matrilysin, uterine) , MPSL1; matrilysin; PUMP 1; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine); MMP-7; MPSL1; PUMP-1; |
| Gene ID | 4316 |
| mRNA Refseq | NM_002423 |
| Protein Refseq | NP_002414 |
| MIM | 178990 |
| UniProt ID | P09237 |
| ◆ Recombinant Proteins | ||
| Mmp7-748M | Recombinant Mouse Mmp7 protein, His-tagged | +Inquiry |
| MMP7-3236H | Recombinant Human MMP7 protein, GST-tagged | +Inquiry |
| MMP7-22H | Active Recombinant Human MMP7 protein | +Inquiry |
| MMP7-001H | Recombinant Human MMP7 Protein, His-tagged | +Inquiry |
| Mmp7-10595M | Recombinant Mouse Mmp7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MMP7-28205TH | Native Human MMP7 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP7-2883HCL | Recombinant Human MMP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP7 Products
Required fields are marked with *
My Review for All MMP7 Products
Required fields are marked with *
