Recombinant Human MMP8 protein, His&Myc-tagged
Cat.No. : | MMP8-1243H |
Product Overview : | Recombinant Human MMP8 protein(P22894)(101-467aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 101-467aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG |
Gene Name | MMP8 matrix metallopeptidase 8 (neutrophil collagenase) [ Homo sapiens ] |
Official Symbol | MMP8 |
Synonyms | MMP8; matrix metallopeptidase 8 (neutrophil collagenase); CLG1, matrix metalloproteinase 8 (neutrophil collagenase); neutrophil collagenase; PMNL collagenase; matrix metalloproteinase-8; matrix metalloproteinase 8 (neutrophil collagenase); HNC; CLG1; MMP-8; PMNL-CL; |
Gene ID | 4317 |
mRNA Refseq | NM_002424 |
Protein Refseq | NP_002415 |
MIM | 120355 |
UniProt ID | P22894 |
◆ Recombinant Proteins | ||
MMP8-154H | Recombinant Human Matrix Metallopeptidase 8, Catalytic Domain | +Inquiry |
Mmp8-1055R | Active Recombinant Rat Mmp8 Protein, His-tagged | +Inquiry |
MMP8-423H | Active Recombinant Human MMP8 | +Inquiry |
MMP8-409H | Recombinant Human Matrix Metallopeptidase 8 (Neutrophil Collagenase) | +Inquiry |
MMP8-41H | Recombinant Human Matrix Metallopeptidase 8 | +Inquiry |
◆ Native Proteins | ||
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP8-2054HCL | Recombinant Human MMP8 cell lysate | +Inquiry |
MMP8-2080MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
MMP8-001MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP8 Products
Required fields are marked with *
My Review for All MMP8 Products
Required fields are marked with *
0
Inquiry Basket