Recombinant Human MMP8 Protein, His-tagged
| Cat.No. : | MMP8-123H |
| Product Overview : | Recombinant Human MMP8 Protien(NP_002415)(119-467 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 119-467 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | MMP8 matrix metallopeptidase 8 (neutrophil collagenase) [ Homo sapiens ] |
| Official Symbol | MMP8 |
| Synonyms | MMP8; matrix metallopeptidase 8 (neutrophil collagenase); CLG1, matrix metalloproteinase 8 (neutrophil collagenase); neutrophil collagenase; PMNL collagenase; matrix metalloproteinase-8; matrix metalloproteinase 8 (neutrophil collagenase); HNC; CLG1; MMP-8; PMNL-CL; |
| Gene ID | 4317 |
| mRNA Refseq | NM_002424 |
| Protein Refseq | NP_002415 |
| MIM | 120355 |
| UniProt ID | P22894 |
| ◆ Recombinant Proteins | ||
| MMP8-409H | Recombinant Human Matrix Metallopeptidase 8 (Neutrophil Collagenase) | +Inquiry |
| Mmp8-1127R | Recombinant Rat Mmp8 Protein, His&SUMO-tagged | +Inquiry |
| Mmp8-3375R | Recombinant Rat Mmp8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mmp8-610M | Active Recombinant Mouse Mmp8 Protein, His-tagged | +Inquiry |
| Mmp8-523M | Recombinant Mouse Mmp8, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
| MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP8-001MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
| MMP8-2054HCL | Recombinant Human MMP8 cell lysate | +Inquiry |
| MMP8-2080MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP8 Products
Required fields are marked with *
My Review for All MMP8 Products
Required fields are marked with *
