Recombinant Human MMP8 Protein, His-tagged
Cat.No. : | MMP8-123H |
Product Overview : | Recombinant Human MMP8 Protien(NP_002415)(119-467 aa), fused to His tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 119-467 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | MMP8 matrix metallopeptidase 8 (neutrophil collagenase) [ Homo sapiens ] |
Official Symbol | MMP8 |
Synonyms | MMP8; matrix metallopeptidase 8 (neutrophil collagenase); CLG1, matrix metalloproteinase 8 (neutrophil collagenase); neutrophil collagenase; PMNL collagenase; matrix metalloproteinase-8; matrix metalloproteinase 8 (neutrophil collagenase); HNC; CLG1; MMP-8; PMNL-CL; |
Gene ID | 4317 |
mRNA Refseq | NM_002424 |
Protein Refseq | NP_002415 |
MIM | 120355 |
UniProt ID | P22894 |
◆ Recombinant Proteins | ||
MMP8-41H | Recombinant Human Matrix Metallopeptidase 8 | +Inquiry |
MMP8-3719R | Recombinant Rat MMP8 Protein | +Inquiry |
MMP8-1449C | Recombinant Cynomolgus MMP8 protein, His-tagged | +Inquiry |
Mmp8-610M | Active Recombinant Mouse Mmp8 Protein, His-tagged | +Inquiry |
MmP8-1187M | Recombinant Mouse MmP8 protein(Phe21-Ser465) | +Inquiry |
◆ Native Proteins | ||
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP8-2054HCL | Recombinant Human MMP8 cell lysate | +Inquiry |
MMP8-2080MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
MMP8-001MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP8 Products
Required fields are marked with *
My Review for All MMP8 Products
Required fields are marked with *