Recombinant Human MMP9, His-tagged
| Cat.No. : | MMP9-77H |
| Product Overview : | MMP-9 Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 338 amino acids fragment (113-450) corresponding to the catalytic domain of the protein, having a total molecular mass of 42.03kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The MMP-9 is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 113-450 a.a. |
| Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. |
| Form : | Sterile Filtered clear solution. (0.57 mg/ml) MMP-9 protein is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol. |
| AA Sequence : | DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGL LAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANY DTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTV MGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHS SVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGP. |
| Purity : | Greater than 95.0% as determined by SDS-PAGE. |
| Stability : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. |
| Gene Name | MMP9 matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) [ Homo sapiens ] |
| Official Symbol | MMP9 |
| Synonyms | MMP9; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); GELB; CLG4B; MMP-9; MANDP2; matrix metalloproteinase 9; type V collagenase; macrophage gelatinase; matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); EC 3.4.24.35; Matrix metalloproteinase-9; 92 kDa type IV collagenase; 92 kDa gelatinase; Gelatinase B; GELB; 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; OTTHUMP00000031674; type V collagenase |
| Gene ID | 4318 |
| mRNA Refseq | NM_004994 |
| Protein Refseq | NP_004985 |
| MIM | 120361 |
| UniProt ID | P14780 |
| Chromosome Location | 20q11.2-q13.1 |
| Pathway | Bladder cancer; Leukocyte transendothelial migration; Pathways in cancer |
| Function | calcium ion binding; collagen binding; metalloendopeptidase activity; peptidase activity; zinc ion binding |
| ◆ Recombinant Proteins | ||
| Mmp9-37H | Active Recombinant Rat Mmp9 protein (20-708aa), C-6×His-tagged | +Inquiry |
| MMP9-03H | Active Recombinant Pre-activated Human MMP9 Protein | +Inquiry |
| MMP9-3378R | Recombinant Rat MMP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MMP9-774H | Recombinant Human MMP9, Catalytic Domain, T7-tagged | +Inquiry |
| MMP9-5468D | Recombinant Dog MMP9 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
| MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
| MMP9-38H | Native Human MMP-9 | +Inquiry |
| MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
| MMP9-29698TH | Native Human MMP9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP9-1940RCL | Recombinant Rat MMP9 cell lysate | +Inquiry |
| MMP9-2026MCL | Recombinant Mouse MMP9 cell lysate | +Inquiry |
| MMP9-2560HCL | Recombinant Human MMP9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP9 Products
Required fields are marked with *
My Review for All MMP9 Products
Required fields are marked with *
