"LHPP" Related Products

Expand

Recombinant Human MMRN2 protein, T7/His-tagged

Cat.No.: LHPP-202H
Product Overview: Recombinant human LHPP cDNA (269 aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSR LKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVV IADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVCPYMKALEYACGIKAEVVGKPSPEFFKS ALQAIGVEAHQAQ
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: LHPP phospholysine phosphohistidine inorganic pyrophosphate phosphatase [ Homo sapiens ]
Official Symbol: LHPP
Synonyms: LHPP; HDHD2B; hLHPP; FLJ44846; FLJ46044; MGC117251; MGC142189; MGC142191;
Gene ID: 64077
mRNA Refseq: NM_001167880
Protein Refseq: NP_001161352
MIM:
UniProt ID: Q9H008
Chromosome Location: 10q26.2
Pathway: Oxidative phosphorylation, organism-specific biosystem; Oxidative phosphorylation, conserved biosystem;
Function: hydrolase activity; inorganic diphosphatase activity; magnesium ion binding; phosphohistidine phosphatase activity; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.