Recombinant Human MMRN2 protein, T7/His-tagged
Cat.No. : | LHPP-202H |
Product Overview : | Recombinant human LHPP cDNA (269 aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 269 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSR LKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVV IADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVCPYMKALEYACGIKAEVVGKPSPEFFKS ALQAIGVEAHQAQ |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | LHPP phospholysine phosphohistidine inorganic pyrophosphate phosphatase [ Homo sapiens ] |
Official Symbol | LHPP |
Synonyms | LHPP; HDHD2B; hLHPP; FLJ44846; FLJ46044; MGC117251; MGC142189; MGC142191; |
Gene ID | 64077 |
mRNA Refseq | NM_001167880 |
Protein Refseq | NP_001161352 |
MIM | |
UniProt ID | Q9H008 |
Chromosome Location | 10q26.2 |
Pathway | Oxidative phosphorylation, organism-specific biosystem; Oxidative phosphorylation, conserved biosystem; |
Function | hydrolase activity; inorganic diphosphatase activity; magnesium ion binding; phosphohistidine phosphatase activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
LHPP-4820H | Recombinant Human LHPP protein, His-SUMO-tagged | +Inquiry |
LHPP-1745H | Recombinant Human LHPP Protein (1-270 aa), His-tagged | +Inquiry |
LHPP-9084M | Recombinant Mouse LHPP Protein | +Inquiry |
LHPP-3403R | Recombinant Rat LHPP Protein | +Inquiry |
LHPP-5731Z | Recombinant Zebrafish LHPP | +Inquiry |
◆ Cell & Tissue Lysates | ||
LHPP-4753HCL | Recombinant Human LHPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHPP Products
Required fields are marked with *
My Review for All LHPP Products
Required fields are marked with *