Recombinant Human MN1 Protein, GST-tagged
Cat.No. : | MN1-5442H |
Product Overview : | Human MN1 partial ORF ( NP_002421, 1212 a.a. - 1320 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis. [provided by RefSeq |
Molecular Mass : | 37.73 kDa |
AA Sequence : | STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MN1 meningioma (disrupted in balanced translocation) 1 [ Homo sapiens ] |
Official Symbol | MN1 |
Synonyms | MN1; meningioma (disrupted in balanced translocation) 1; meningioma chromosome region , MGCR; probable tumor suppressor protein MN1; MGCR1; MGCR1 PEN; meningioma chromosome region 1; meningioma (translocation balanced); MGCR; MGCR1-PEN; dJ353E16.2; |
Gene ID | 4330 |
mRNA Refseq | NM_002430 |
Protein Refseq | NP_002421 |
MIM | 156100 |
UniProt ID | Q10571 |
◆ Recombinant Proteins | ||
MN1-5442H | Recombinant Human MN1 Protein, GST-tagged | +Inquiry |
MN1-28419TH | Recombinant Human MN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MN1 Products
Required fields are marked with *
My Review for All MN1 Products
Required fields are marked with *