Recombinant Human MN1 Protein, GST-tagged

Cat.No. : MN1-5442H
Product Overview : Human MN1 partial ORF ( NP_002421, 1212 a.a. - 1320 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis. [provided by RefSeq
Molecular Mass : 37.73 kDa
AA Sequence : STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MN1 meningioma (disrupted in balanced translocation) 1 [ Homo sapiens ]
Official Symbol MN1
Synonyms MN1; meningioma (disrupted in balanced translocation) 1; meningioma chromosome region , MGCR; probable tumor suppressor protein MN1; MGCR1; MGCR1 PEN; meningioma chromosome region 1; meningioma (translocation balanced); MGCR; MGCR1-PEN; dJ353E16.2;
Gene ID 4330
mRNA Refseq NM_002430
Protein Refseq NP_002421
MIM 156100
UniProt ID Q10571

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MN1 Products

Required fields are marked with *

My Review for All MN1 Products

Required fields are marked with *

0
cart-icon