Recombinant Human MOBP Protein, GST-tagged
Cat.No. : | MOBP-5461H |
Product Overview : | Human MOBP full-length ORF ( AAH22471, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MOBP (Myelin-Associated Oligodendrocyte Basic Protein) is a Protein Coding gene. Diseases associated with MOBP include Substance Abuse and Corticobasal Degeneration. GO annotations related to this gene include Rab GTPase binding and structural constituent of myelin sheath. An important paralog of this gene is MYRIP. |
Molecular Mass : | 34.65 kDa |
AA Sequence : | MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOBP myelin-associated oligodendrocyte basic protein [ Homo sapiens ] |
Official Symbol | MOBP |
Synonyms | MOBP; myelin-associated oligodendrocyte basic protein; MGC87379; |
Gene ID | 4336 |
mRNA Refseq | NM_182935 |
Protein Refseq | NP_891980 |
MIM | 600948 |
UniProt ID | Q13875 |
◆ Recombinant Proteins | ||
MOBP-9947M | Recombinant Mouse MOBP Protein | +Inquiry |
MOBP-2803R | Recombinant Rhesus monkey MOBP Protein, His-tagged | +Inquiry |
MOBP-2623R | Recombinant Rhesus Macaque MOBP Protein, His (Fc)-Avi-tagged | +Inquiry |
MOBP-930H | Recombinant Human MOBP, GST-tagged | +Inquiry |
MOBP-6297HF | Recombinant Full Length Human MOBP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOBP-4262HCL | Recombinant Human MOBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOBP Products
Required fields are marked with *
My Review for All MOBP Products
Required fields are marked with *